SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N4XFQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N4XFQ0
Domain Number 1 Region: 87-161
Classification Level Classification E-value
Superfamily BEACH domain 9.16e-23
Family BEACH domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N4XFQ0
Sequence length 181
Comment (tr|A0A0N4XFQ0|A0A0N4XFQ0_NIPBR) Uncharacterized protein {ECO:0000313|WBParaSite:NBR_0000135201-mRNA-1} KW=Complete proteome; Reference proteome OX=27835 OS=Nippostrongylus brasiliensis (Rat hookworm). GN= OC=Nippostrongylus.
Sequence
MKSDVWNENAFKELLIPAVVGFTSNDCSDVERKTLLGATVVLRKLPSTFSFSSEATTTTN
EQTCDDRWKDIASRFGACYARLEGVLNLIQNFSKATSKWVNGAMSNYDYILELNKAAGRV
RGEVHNHPVFPWVCDFKEANGGWRDLSKTKYRLTKGDDQLGFVQVWRFFLDSTEAVLIRN
I
Download sequence
Identical sequences A0A0N4XFQ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]