SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0N4Y5L9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N4Y5L9
Domain Number 1 Region: 23-196
Classification Level Classification E-value
Superfamily MIR domain 2.22e-56
Family MIR domain 0.000000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N4Y5L9
Sequence length 205
Comment (tr|A0A0N4Y5L9|A0A0N4Y5L9_NIPBR) Uncharacterized protein {ECO:0000313|WBParaSite:NBR_0001130601-mRNA-1} KW=Complete proteome; Reference proteome OX=27835 OS=Nippostrongylus brasiliensis (Rat hookworm). GN= OC=Nippostrongylus.
Sequence
MRWLTVLVAISNVHWSFSYRDVPITCRSVVKLANTNEAGARLHSHDVKYGSGSGQQSVTA
VTSSDDVNSHWQIYPAFESNCHRGDPIKCGDKIRLKHLTTGCFLHSHHFQAPLSKSYQEI
SCFGGPKSQSDTGDNWHIICDGDEWMESDSVKIKHVDTSVFLALSGNEFGRPIHGQKEVV
GTDGFTSGGRWKVAEGVFMKENKEL
Download sequence
Identical sequences A0A0N4Y5L9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]