SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0N4Y873 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N4Y873
Domain Number 1 Region: 484-655
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 9.55e-43
Family IP3 receptor type 1 binding core, domain 2 0.00000899
Further Details:      
 
Domain Number 2 Region: 251-348,382-482
Classification Level Classification E-value
Superfamily MIR domain 2.79e-40
Family MIR domain 0.0000433
Further Details:      
 
Domain Number 3 Region: 114-183
Classification Level Classification E-value
Superfamily MIR domain 0.0000000157
Family MIR domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0N4Y873
Sequence length 1212
Comment (tr|A0A0N4Y873|A0A0N4Y873_NIPBR) Uncharacterized protein {ECO:0000313|WBParaSite:NBR_0001240301-mRNA-1} KW=Complete proteome; Reference proteome OX=27835 OS=Nippostrongylus brasiliensis (Rat hookworm). GN= OC=Nippostrongylus.
Sequence
MSLPFLRKSSLCTSMDGGNTSLLHFGDIISLYTEDLVDDRCIVELRDGRPESPPKKFRDC
LFKVCPVNRYAAQKQFWTEQKRFLSGESTFDDDMMNKLRIAAEKEKEQNELEFRKTQGNV
IQYGTTVQLLHVKSDKYVTVQKNSPAKCERNAMKVYLDRAGNEGSWFIIEPAYKHYVIGD
SIAAGNKISLIPYSVNNQTSGHVKHQLHLSHYLLKDHQSAAEVNCLNECTEWQVFMFLLF
NENQPDIVKSGDVVRLFHADQQTFLTLDSIPKSCPPQDVVFLRMTNRPSAADATSSRALW
EVQVVQKDAYRGGAAKWREYYRFKHLATDMYLTATPATTAVKPASNGRRASLMHMNKSKG
TLERTKAEFLAPPSSQLYADGPDNMDECPLGTYFLVPVKSDFPEADRKLLFTLDPGIMPM
NKDVPSKSYVRLQHEATGTWVHATSATEKQNLYYSSKNEKGWVRVICENNRVDKETFALL
PVQPNEVRDLDFANDACRALRNFIRHIKSGDPVTKEAINVTIQLLTECIYFVTSTKNHMM
DPLRITDFNPSRDRQKLLREQEVLDQVFQLLKAPFMPRQGLTEIGPLLSSPSELGEARNE
VFKTMFQLCYSLLRYSQVSYRKNQEFLAEKFGQIQEQIGFDLLAEDTMTAVLHNNPKLLE
KYVKTPHVERFVELVRNNRLGKFLDYLADLCVCRGEANKKVQELICNSVLSEKHRDILME
TKLIDGEVHIGWMGQQPMRSLVELAESAKRNSDDADFLDYYRHQLDLLAQMCQEQQYLAI
DPPPERKLLNISQQLPTDLVLRYKASSVEGYGDGGRARVGDLFAIDVLNTVEGYLNSLRN
NHPSGPVLQKDAASVANNKLTYEMVTLAKALAQFGYYTFDNLLTLTENLLNIVDNSPHSA
QTARTVSHGMTMIHRVTQSMIGTGPSKISDMPIKSVDKNNIEDSVREKESRQLLVKTKLT
VAEILQFVMDVRRDYRITMALSWFKQNFPCNEEGVLDHTANINEKMAHELYEAIYQSSGH
ELHLDGGDGQLLLAILMQMTMSDYPPLTSISLKVLFRHFTQYQELLEDLKQVQLLVSSDD
VENYRQVDRDLFILKNLTEKSELWVHGDRHHSVDGKENENEKTTKMDFEEHALVTPKAFA
TDESLKAVVDIIDEHYPTSRKECLRLLNQVFIYYSIFIIFVFIFLFICIYFYVIISISYS
NLRSPIYNKVKR
Download sequence
Identical sequences A0A0N4Y873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]