SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0N4ZIS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N4ZIS5
Domain Number 1 Region: 514-687
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 8.76e-39
Family IP3 receptor type 1 binding core, domain 2 0.0000118
Further Details:      
 
Domain Number 2 Region: 271-511
Classification Level Classification E-value
Superfamily MIR domain 3.66e-36
Family MIR domain 0.0000478
Further Details:      
 
Domain Number 3 Region: 1275-1431
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 3.79e-20
Family IP3 receptor type 1 binding core, domain 2 0.0082
Further Details:      
 
Domain Number 4 Region: 133-209
Classification Level Classification E-value
Superfamily MIR domain 0.00000000131
Family MIR domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0N4ZIS5
Sequence length 2933
Comment (tr|A0A0N4ZIS5|A0A0N4ZIS5_PARTI) Uncharacterized protein {ECO:0000313|WBParaSite:PTRK_0000783700.1} KW=Complete proteome; Reference proteome OX=131310 OS=Parastrongyloides trichosuri (Possum-specific nematode worm). GN= OC=Parastrongyloides.
Sequence
MEENLLQSRERFTSSNNVSLDAFHNTNLHIGDVISLYAIDNSEKKMYEGFLSTLGLVDDR
CLVELRNGSLQSPPKNYRDCLFRVCPVYRYAAQKQYWSEQKKCLAGDGSEKEMLIKLKNA
AEKEKEQNELEYRKMLGTQIQYGTSIQLLHVKSNKYLTMQKNSPAKVERNAMRVYLDKVG
NEGSWFIVEPVYKHVAIGYGVMSSERIYLVPYANGNQNSLGHIKHQLHLSRQHLKDHQNA
CEVNILNESTEWQVNLFLQYDENLTDFVKSGDVVRLFHADQQTFLTLDTISNKNKLKNDE
KKDNDNKVVVKKKDEKKEEVVFLRLTNRSSAADATSSKALWEIQIFNRDFAYRGGAATWR
KFIRFKHLATDLYLTVLPYDMVKHEIDTERKISNHSFGNHLGDEVDMYKYLNNKDSKGNC
YILTPSYSNDPAKDESLLFILDPCKITSGKDQKVPIDSFVRIQHYKTGAWIHTTDPSLKT
NLFYFDKSEKGWVKVICEENKIDKEAFALSKVSPHEVRDLDFANDASKALMQFIALMLSG
QSIPKDMTNTTCQLLIECIYFVTGISDHMIDPLNIVDFSPSRDRQKLLREQGVLAQVFAL
LKAPFQKRKGKDNKEIDPLFESGEALNEQRNLVFKKMFRYCYALLKYAQSGYRKNQEFLA
GKFDQIQEQIGLDLLAEDTMTAVLHNNPKLLEKYVKTPHVERFVELVRKNKSGKFLDYLA
DLCVCRGEANKKIQELICNSVLSEGNRDIFMETEKRPILNPTPEDIKFFRKYQIYLCTQG
TYCKSLLNCSLDANSNKEDAGMLDYYRHQLGLLAQMCQDQQYLAIDPPPERHLLNVSKEL
PIELIIQCMADTRLPDDIRASFTRLMLHLHVVRGSPVSAVRHARLWRDIPIDVTVEKYSS
SAVEGYVDGSRSKHADVESFKDVLKIVDRYLEGMIKNTKPNEPILNESGSYCDANRFTYE
IVNLSRALAQFGFYSFTELLRLAQNLLAIADGNPTQSSSFVKKGMKMLTDMTTNIVPSDY
NLSSSSQNRCNYIINNSDLQGEDALRGKQSRELVLQTKLIIVDILQFIMDVKRDYRISVA
LSWFKKQYPCNEDGELQNYSNEIEDKPEELCSVVFESIDSELDFDGEKGQQLLRILMQMT
MNDFPTLTSMALKVLFRHFTQYHELVEDLKQVQLLVSNNDVDNYHQIDRDVFILKNLTEK
SELWVHWGVNNDNVSVSQTQEKPSKMGSLKRQDTLEITFHSEDSPTNNSLDDDWENDLDE
SIKNDINSIPKHLLEFVEDNYKSSRKSCILLLVTLLKSQDKKDTSSALHDLMDKAPLLGY
PLLEDILERYESLCHKEQKADSMNQQLLRNMRVYEVVLEFLRIPFDKKNDHKMPHLITLS
HLFLRSFCKNNKENQNRLHKFISIENGSNDGQLCIETLEEVETLTCIFQNNLELSDNVNE
GLISHVVRLIEHKGKDAILLKYLQAIVIDHDNEIESAQSKVVEEIQKATDDVKQVYVDAA
SFEQLKEMMKQHKDDSHELPSSHPLIYHIELVRLMALCTKGKNGNTELKCASILPMDQIV
RVITYEHCNYQVKSVYVQFMMHCYIDTDIELKDARNVEYIDQILKNICEDMKVYNKGILN
TGTTSYLTLPNIKTKDSFLENLETYIGKYVTKLLIKFFTSNYSNTAIIDIRQHKTTFIQI
VNELNVAANKRLRKSGITNWYSIGNCLKFMKKVASDNNITLIANMAINDMKPSPMNGITR
FQNAVKATKLFMDKNNHNSSSHSNLPTVRIPAQDGYTSNVVIRYQEIINVFKIHLMPLQS
AECSVLVDVLHLPEKLFPVDSPLSYQCENGKAVTKLIQHCKLLLENKQENLCIRVIQTLC
KMANCTNQDFVGEAKKLRLILLKRYFGSHVVEPPHEPMKLQNMGRTHDSNNESNNKNNYI
FNSDLKPIKSISLHEIQCKLNNAGAVDLVIELVIADISQEIFVKACQLAKALLYEGNEEV
QKSFYTRLKDKQVSGKFFSTFVNKFQSAQNRLKADMMSGNTVRQRSASAMVTPLPYATEN
AHDNSSLSLSLLHNGLLGLNQPNNDSNNSSLSNQNSTLLNQNSLILNHNSHRHSIGSETD
TINMGINNYDFINFHEDDKYKDILPQEVAIMEPILRFLQLLCENHNNLLQDYLRTQGERP
DHNLVAETLTFLDIICGSTKGSLGVFAEIGEHNFSLIKQTLITLTEFCQGPCHENQDTLA
FHESNGLDIIISLVLNDIRPLADEHTEKALEIKCNASKLLLAVMESRHDSENAERVLRNM
THTTVGISQLINAISQTYNMDETTDFGNIKSEEHNSDFKYPSIFSNDKLRSFGSLSCYQN
DSPAIAPKDVGHNIYILAHQLSRHSVELGTQLDPDYHKDIKIKNALQYYKEHTAQIEIVR
EDRNLERVVFPIYDICLYLTPETQNFVYMNTERDNQGSKVTDFFEKWEQLYDEMKWQRKL
ENRVILSGVTQLLPLWGRLSLFFAVLVNLVIGLYYPFGSNSEQIFSHKNPTIYGIIILSM
TYIYFSVMKSFNTKFKHSKISHYAVMVLLANFGLIIKCTVGIESFLNIFGILQLINKVIY
IIAYVGNKGLIDKTWKERMRDSKLWYHIAYCGACFLGTTIHPFLFALLLFDVVASEETLR
NVIRSVTRNWQSIILTGMLALILVYQFSIIGYTLFQKDFKLEIDSVDSSDTSTCQDNDVD
PFLISRIKNNIEETKSCDNLNDKKEEEKNEVPACNTLRMCILTTLNWGLRNGGGIGDVLR
NVSPDEESFHMRIIYDLSFFVVLIIIVLNLIFGVIIDTFGDLRSEKNEREDVLKNTCFIC
GLERGKFDNHSVSFETHRNNEHNLWHYLFFIVLLQEKDSTEFTGPESYVAECVKSKSIDW
FPRMQAISLMEDGSDNDQPEYKDLEMQVKQQEILLREIYSKLQLMQRSYSDND
Download sequence
Identical sequences A0A0N4ZIS5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]