SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0N4ZPH7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N4ZPH7
Domain Number 1 Region: 226-401
Classification Level Classification E-value
Superfamily MIR domain 4.05e-36
Family MIR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1079-1215
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-25
Family SPRY domain 0.017
Further Details:      
 
Domain Number 3 Region: 4367-4442
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000578
Family Calmodulin-like 0.057
Further Details:      
 
Domain Number 4 Region: 672-803
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000475
Family Galectin (animal S-lectin) 0.073
Further Details:      
 
Domain Number 5 Region: 108-187
Classification Level Classification E-value
Superfamily MIR domain 0.0000000288
Family MIR domain 0.02
Further Details:      
 
Domain Number 6 Region: 414-545
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000327
Family IP3 receptor type 1 binding core, domain 2 0.0054
Further Details:      
 
Domain Number 7 Region: 2265-2388
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000798
Family IP3 receptor type 1 binding core, domain 2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N4ZPH7
Sequence length 5293
Comment (tr|A0A0N4ZPH7|A0A0N4ZPH7_PARTI) Uncharacterized protein {ECO:0000313|WBParaSite:PTRK_0001043700.3} KW=Complete proteome; Reference proteome OX=131310 OS=Parastrongyloides trichosuri (Possum-specific nematode worm). GN= OC=Parastrongyloides.
Sequence
MVEKEETPGGEQDDVSFLRTGDIVALTCVSSNTKDGAMGSERVCLSTEGFANRMCVLENV
SDKDVPPDISQCMLYIDNALSVRALQEMMSAENEVKGTGGSGGHKTLLYGHAVQLKHVQS
EMYLACLNSCSSSDKLSFDVGVQESNDGETCWWTIHPASKQRSEGEKVRVGDDVILVSVA
TERYLHMALGKNEQYIVIASFHQTLWNIASVSSGSIRNRNMGVLFGNDVLRLFHGNDECL
TIPENWSENQQHNVVIYEGGNAVSQARSLWRVELVRMKWHGAMIGYDQTFRIRHITTGRY
LGVVENAVILLQKDKADFETTAFIMCPNKDPKKAILEEKEEEGMGFATIRYGEEDTFIQH
HKTQLWLSYQTTEVTKKGLGKVEEKKAVALKDGHMDDCYTFFMALEEESKSARVIRKCSS
VLNRFLKGVEALQNEGNQSYEWKRVNLKSVLKLMEDLIEYFAQPTEEHTFEERQVRFRAL
RSRQDLFQEEGVLNMILDTIDKFSQMEALPDFNGLIGDKNQAIWEEISTYLYLLVAAMIK
GNHSNCAQFAAAQRLDWLFGRLSNPQSAEGILDVLYCVLTESPEALNMINEGHIKSVISL
LEKVGRDPKVLDVLSSLCEGNGMAVRSSQNTIADHLLPGKDLLLQTVMRDHVSSVMPNIL
VGVVEGSSLYRKWYFETEVEHIENTTKSQPLLRIGWANTIGFKPYPGSGNGWGCNGCGDD
FFSYSYDGKCLWFSGKARPCGARLFKKGDVIGCSLNLTIPEIRFYLNGTQIHTVFRNFNF
DGFFFPVMSLSSKVSCRFLFGGDHGKLKYGPPEGFSPIFEAVDKNLEIAEVLSFGDLPKS
IYCGTSNILNNIEPFVPEPVDISKVTLSSFAVQHQSQFAQNLHELWAMKKISLGWSYAPN
RSETLKTHPCLTSFETLPGTEKDYNLKLAIDTMKTIEALGYHMILDKPPTRMRPIRLPNN
FLMSNGYKPQPLDTHEIILSESMGTTLVEALAKNIHNVWAKEKIKRGYTFGVHEVVNSTQ
KRSPHLVPYENVDIRIKEANKETARETIKVLQLFGIFLECPAIEHDEQAEKEFKAKKASS
ITYRAEASYAVTSGKWYFEFEVLTNGFMRIGWADISCHPETKVGSDDKSYAFDGYLGKKW
HQGAESYGKEWKIGDIVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNVINGDGFVPCM
TLSAGQRARLNFGQESNSLKFFTTCGLQEGYEPFCVNMYRQMPMWYGKNLPMFREISHVD
SALEMSRILPTSNTPPCLKLTLKTSNNDGNSSDKINQMEFIRLSLPVKVNSSLIVNNEKQ
KTIEAMKEFCAASGEPDSDSEKEGKKKKKGLLSAFGRKGRRDSDDERSSKAHHSIGEFDM
TETTVAQIQRERLKILHEFGCHSYNNTVLTYLTVGISQREKKIFWKNVLSGKEECGDSHS
DSQHDKVSTKSKEKKPGIFKRIRDASHTRQKEKHVEPKKYRTTEILPNTITTVSKRDSSV
FVDSNQGSIDVLADMPVSGPGRKSIKRKGSKNATHNKTTGTRGSIISTTMGFEDPNLNCD
KDADAEAMKVLGENINDYYYGLRIFPGQDPSSVYVGWVTPQYHSHVSSFKNSQAVRSCKF
AELELSGMLTMPNESIEFKNCFLLNAGELLTCVNDTTNTKVTGVLIGCVIDTAAGELSFY
VEGQDTGRKFKLEAGLMLYPAAFVIPTSSEVCQFELGRVRYTWPLSAALFKSSSKSLIPY
CPPRLGVQVLTPYHWARVPNECLRTTALKLSDVRGWSVLCDHPVRVMLIHIPEKYKSYDI
LELIEMPELLAFHRQTLNLYCKLASHGNQKVSHILCQHVDEDQVMYAIKNHFLSGSMRQG
FHDFLIACHLKTHTDAILSTSHEYVLPLVPELMYKDVFTDDSDGRYPHILGQSVCIRPIV
KSDNPVKSFTKDSQVKLLPPSFNFNALKNYVMSAFGEAMHHAVMNCRDLIGGNNLDHFEP
LFKLFDNLLIMGLVNDDELIEILKYLHPAAFDENYKPGTKLKGILDIDFAEGVKLQLVNI
LDHLCDIQLRNRIESLVAFSEGFVGELQQDQCARYMDIKQTDMPPAEAARRTKEFRCPPN
EQMYRLLGCKKKEDKEGMLLDDDVEYDQCPMADTLQDQLRDFCNLLVTKCGCNDVEEDVS
KIEEIIDMDEETSWVDSLAHLVVSVPPSAMDDEEVVARQGTKNFRNMIVQLLKQWATDST
IESNELIRRMFALLLRQYNGIRELMDGMGKTYVFHERNVEDVQNFVTFLMQIRELLTVQF
ETTEEVILKRALWQLMNNRIFFQHPDLMRLLKVHENVMTIMMNVLTAQQNTVEIEKDPDD
PSGSGSIKDASEMVVACSRFLCYFCRTSRQNQKAMFEHLSFLLDNATMLLARPSLRGSVP
LDVAYSSFMDNNELALALKEEELDKVTVYLSRCGLQPNSELIAKEYPDIGWDPLEGERYI
DFLRFCVWINGENVEENANLVIRLLIRRPECLGVALKGEGQGLYLAFQEAIALSEDINEL
ENGIAVEYLRSPIFKEHPHYPSKEIEGDDYVDLGASILDFYSSLVDLLAKCAPDPMTLQE
GKGDSVRARAILRSLISLDDLGKILALRFKIPNLRCVLDGMFIPKVILSNNTPTNLASIA
DDLTKKKLIMSLNNEMHENNMIRNAKSLNVIYENDENSGESSYDTASESISSSPIRRAKT
QVKKLKKKRILKLREFDIEENLNFIKMAKNRRRRNEIESFINNAGPQPGLMPSHKASVLL
FLDRVYGIDSQEMLFSFMEQSFLPDLRAATMMDSPKATESDNALALNRYLCNCVLPLLTN
HSHFFADAEHHSALLDATLHTVYRMNRLQSLTKNQRDAVSDFLVAITRELPPAMMIKLLR
KVIIDIQEMKENVLVPLRIMTLHYERCNKYYGSGNHYGVANETEKRLSMLLFYAIFDSLG
SKPYDPELFGKALPCLTAIGSAISPDYSLTSGSEDTELAKVKDDEGSWSPKPVPIDDIPL
KSELNDMINKFAEHFHDSWSARKLEKGWKFAELYSRVEKTHPRLKPFKLLKDTEKNFYKD
RCAESIKSLLAWNYVIEVYDFDAAEKSAQNHVSSGTCIQDFNPKPVDLSNMNLEKDMMSA
AEKIAENSHNIWCKKIFNEISGKPSSLPPSLVPWDLLTDFERRKNRFHAAEILKFLQYHG
YRVNMSPTSTPTKERTKIEGERGNVEKRFAYNLLEKLIQYLEQASYKMKSVKPSQELTRR
NSFKKEGQDVKFFEKVVLPMMHAYFNAHKNYFLESSIMVQTGTASNKEKEMVASLFCRLA
ALLRIKNHAFGSVAKITVKCLQGLTQALDLRTLVKINSDIIRTGLYTFFNNCADDLLTAV
NELKNGGQYSLLRGQNLKSWISLEFANQMIIPCLTTMFHHLARHHFGADLLLDDIQASCY
KILDSLYMVTGIQTSYENRTSILLEVEKHRPSLGQCLSAFASTFPVAFLEPEFNQNNKYS
VLAKSADQSVQVQEMLQNLSSHIPTLENLMIRIEQTAQNSIPYNQAANVYDVDLPLACTY
LTYWWNMGENGPNSNQHALPITRANSEYMNRIFCALLAMIRDHIGCENGQWLCRVTYFAV
PIIQHVTCDPVKEYLLPIAEKLCTAAELSYKEEERMRTHPDDADEGTVAEDNAKLVRDVY
AFFPILMKYTDLHRAKWLKGPSWESDRIYENVAVIFKIWSFSQVFKREELNYMAQFEEDQ
LNSGGEMKTGKAAIAERKKKRREGLVKKDKHANSIVIACLKRLLPVGLNVFGGRELDIVQ
QSKEKFLNKENEEKIREFIRGLSEIPVKTDPTDKNAWQLSLYTKIGKSQMRGKDTMNQDA
VVEKIANMGQVVAILHSNTRLIEKRKRRFFRTDHPSGAHCSSWKKMLSSQRKRAVVACFR
MVPLYGIPSRQEKEDKWKKVLTLQRKRMAISLITASHLYKVDKHRGINFFLPAFSKLWLE
EEDIGQDKLVQDLCADCEEVESSAVARLFDDDGVLIGDESTEVVNNIAPDPLAQLIQCFQ
RAATTEESQALIIASDELYVNFAQVMAKSVHIEEEDDDGGDDDGEVDQAQKEEMAQTLRA
EQAVLADRGAAIMCLMYISASNGEPSDMVAKTLQLGIHLLSGGNTVIQKMLIDYLQLKKD
VRFFTSIAGLMNNCSVLNLEMFERQIKAEGLGMGAELAAGENQNLNDAEFTCDLFRFLQL
TCEGHNLEFQNYLRTQPGHTTSVNLINCIVDYLLRLQESVMDFYWHYSSKEMIDEGGKEY
FLRAIQVCSQVFNTLTESIQGPCVGNQMTLANSRLWDAINGFFFLFAHMMEKLYKNSTQL
ELLREFLNLQKDMIVLMLSMLEGNVLNGAIGKQMVDALVESQQCVEMILKFSDMFLKLKD
LTTSQAFQDFDTNKDGWISPKEFQKAMESQKMYSVEEITYLMMCTDVNNDGKVDYMEFTE
RFHNPARDIGFNLAVLLTNLKEHITSDPRLEKIIEKASTLLEYFDPFLGRIEIMGSSKRV
EKIYFEIQESWLEQWSKQQIRDSKNAFLFNVLQDDGGDQGKLEAFINFCEDTIFEMQHAA
EISSGDGSDSKMERALKQRDYFLQQTTAGTELTKTMKAGYSMGINAAAALKPENLQRSFH
HVSGKVHSMTWFQLIFSILHFCFIFIKEGILIIFTVLTTLIRFLYYMTLSGKEDEVHKPV
DIKESRRQHITKPTNPFTKDLPDFKFEPHHEYDAFGVHIPHEDHHNDTNNKKYTDGTPPP
DPAPSPTINIQTDDTLHVPENKSTPSPSPHHFSTPGSVHDSQSNVGSVQYLPLPLASPEQ
GPIVSNYEPKIAEIAAARSRGSILNMLARNFKTIEKMTLYLAFFINVILLFHRVDITSQN
EEGGEVVETEEVIDDDDNEATNEFIYITGLAIPYISYEITGWVLSQVLYWLSVFHAFCSF
ALLISFYQLKIPLITFKREKEVARKLMFDGCWITEDNTEEQGFMDTITWYLDRIVIVSKS
FPMKYWDKFVRRKTKVKYKDQVDEETLNKLLGEERAPGDTSFDYRYNCWLWFGVILTNAQ
FLYRVGYLICSTCGVVFSPFFYAFHLIDVVLSFPMLKAILQSVTHNLQQLILTIMMTLVV
VYLYTVLAFNFFRKFYVQEGEDGEEPDRKCHNMLTCFIYHFYAGVRAGGGIADEIESPYG
DEMEYPRMLYDISFFFFVIVILLAIMQGLIIDAFGELRDQQEAATEKLESSCFICDIGKE
TFDRMPRGFEIHTTKEHNFANYLFFLQHLVNKDETEYTGQETYVREKYDNRDWEFFPVGE
CFMKQYEDQLLQP
Download sequence
Identical sequences A0A0N4ZPH7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]