SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N5ABH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N5ABH4
Domain Number 1 Region: 65-172
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 3.92e-27
Family Transducin (alpha subunit), insertion domain 0.00022
Further Details:      
 
Domain Number 2 Region: 16-62,175-191
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000927
Family G proteins 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N5ABH4
Sequence length 191
Comment (tr|A0A0N5ABH4|A0A0N5ABH4_9BILA) Uncharacterized protein {ECO:0000313|WBParaSite:SMUV_0000150001-mRNA-1} KW=Complete proteome; Reference proteome OX=451379 OS=Syphacia muris. GN= OC=Oxyuroidea; Oxyuridae; Syphacia.
Sequence
MTGVLCCLKEGDDQTRRIERQLRKEKVQLRSQVKILLLGSGESGKSTFIKQMVIIHGKGE
FTADENVISAMRVLLDARQKLGFSWQDPCRKAHVAAIMRFTATDLMKGIDQPTFSEIAPK
IRDLWDDQAIKQTFEQRNLFQISDSCSYFFEHINRVAMPNFYPTNRDILFCRKATRGITE
HVFEIQRIPFR
Download sequence
Identical sequences A0A0N5ABH4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]