SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N5BI72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N5BI72
Domain Number 1 Region: 63-118
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000183
Family ATI-like 0.011
Further Details:      
 
Domain Number 2 Region: 223-280
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000034
Family ATI-like 0.0091
Further Details:      
 
Domain Number 3 Region: 137-191
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000343
Family ATI-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N5BI72
Sequence length 281
Comment (tr|A0A0N5BI72|A0A0N5BI72_STREA) Uncharacterized protein {ECO:0000313|WBParaSite:SPAL_0000565400.1} KW=Complete proteome; Reference proteome OX=174720 OS=Strongyloides papillosus (Intestinal threadworm). GN= OC=Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides.
Sequence
MKFVKFSIILLVSTVSVTHGQNNDFKNKAIQNMKGKFGPVRVRLPGFIDTKIDEPGNATL
TDRTCRQNMTYTECGGCERTCLNREMACTMMCRPPGCYCNSGYLLNEHGSCILESDCPQP
ESAEPVDPPAVIVDDSKTCPKNYTYLECGTCNDKCGGPVMCTRECKKPGCYCVVTASLDN
DNNCILKSDCPNEDPKNKPPRSKMIIKILGKRPRRCKDTPIPTRKCKKNETWNKCGNRCE
GTCKKEDKMCIEICGPGACVCSKGFLRNDNGVCVPKDNCPK
Download sequence
Identical sequences A0A0N5BI72

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]