SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0N5BIM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N5BIM7
Domain Number 1 Region: 226-401
Classification Level Classification E-value
Superfamily MIR domain 3.27e-36
Family MIR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1080-1216
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-25
Family SPRY domain 0.016
Further Details:      
 
Domain Number 3 Region: 4255-4330
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000564
Family Calmodulin-like 0.057
Further Details:      
 
Domain Number 4 Region: 672-804
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000174
Family Galectin (animal S-lectin) 0.074
Further Details:      
 
Domain Number 5 Region: 108-187
Classification Level Classification E-value
Superfamily MIR domain 0.0000000118
Family MIR domain 0.02
Further Details:      
 
Domain Number 6 Region: 414-545
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000497
Family IP3 receptor type 1 binding core, domain 2 0.0065
Further Details:      
 
Domain Number 7 Region: 2291-2394
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000889
Family IP3 receptor type 1 binding core, domain 2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N5BIM7
Sequence length 5177
Comment (tr|A0A0N5BIM7|A0A0N5BIM7_STREA) Uncharacterized protein {ECO:0000313|WBParaSite:SPAL_0000580700.1} KW=Complete proteome; Reference proteome OX=174720 OS=Strongyloides papillosus (Intestinal threadworm). GN= OC=Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides.
Sequence
MVEKEETPGGEQDDVSFLRTGDIVALTCVSSNTKDGAMGSERVCLSTEGFANRMCVLENV
SDKDVPPDISQCMLYIDNALSVRALQEMMSAGNEVKGTSGSGGHKTLLYGHAVQLKHVQS
EMYLACLNSCSSSDKLSFDVGVQESNDGETSWWTIHPASKQRSEGEKVRVGDDVILVSVA
TERYLHMALGKNDQYIVIASFHQTLWNIASVSSGSIRNRNMGVLFGNDVLRLFHGNDECL
TIPENWSENQAHNVIIYEGGNAVSQARSLWRVELIRMKWHGAMIGYDQTFRIRHITTGRY
LGVLDNAVILLQKEKADFETTAFVMCPNKDPKKAMLEEKEEEGMGVATVRYGETDTFIQH
HKTQLWLSYQTTEVTKKGLGKVEEKKAVALKDGHMDDCYTFFMALEEESKSARVIRKCSS
VLNRFLKGVEALQNEGNQSLEWNRVNLNSVLKLMEDLIEYFAQPTEEHTFEERQVRFRAL
RSRQDLFQEEGVLNMILDTIDKFSQMEALPDFNGLIGDKNQTIWEEISTYLYLLVAAMIK
GNHSNCAQFAAAQRLDWLFGRLSNPQSAEGILDVLYCVLTESPEALNMINEGHIKSVISL
LEKVGRDPKVLDVLSSLCEGNGMAVRSSQNTIADHLLPGKDLLLQTVMRDHVSSVMPNIL
VGVVEGSCLYRKWYFETEVEHIESTTKSQPLLRIGWANTLGFKPYPGSGNGWGCNGCGDD
FFSYGFDGRYMWFSGKARNSGNNRLFAKGDVIGCSLNLTIPEIRFYLNGFPIQTTFRNFN
FDGFFFPVMSLSSKVSCRFLFGGDHGKLKYGPPDGFSPVYEAVEKKLEIAEVLSFGDLTK
NIYSGTSNILNNIEPFVPEPVDISKITLASFAVQHHTQFAQNLHELWAMKKISLGWTYAP
NRSETLKTHPCLISFDQLPSTEKEYNLKLAIDTMRTIEALGYHMILDKPPTRMRPIRLPN
NFLMSNGFKPQPLDTHEIILSEALETTLVEALAKNIHNVWAKEKIKRGYTFGVNEIITST
QKRSPHLVPYEDVDKRIKEANKETARETIKVLQLFGIFLEAPAIEHDEQAEKEFTAKKAS
SITYRAETSYAVTSGKWYFEFEVLTNGFMRIGWADISCHPDTKVGSDDKSYAFDGYLGKK
WHQGAESYGKEWKVGDIVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNIINGDGFVPC
MTLSAGQRARLNFGQDSNSLKFFTTCGLQEGYEPFCVNMYRQMPMWYGKSLPMFREISHV
ESALEMSRILPTSNTPPCLKLTLKTTNNDGSSSDKINHMEFLRLSLPVKVNSSLIYNDEK
ERTIEAIKEYQYSHMTEHEEDSERDGKKKKKGLLSAFGRKGKRESDDDVHGGKATLHSSI
GEFDVSEGAAAHRQRERLKILIEFGCHSYDSTVLTYLTDGNNDTEKKRFWKDCMSSRDEG
GDSHSDSQHDKVSTKSKEKKPGIFKRIRDASHTRIKEKPPPEPKKYRTTEILPATVMAKR
DSNVFIDSHQGSIDVLADMPVSGPGRKSFKRKGSKNAANMKQYQATRGSIISTALGLEDS
NLITDKDSDVQAMQTLGEGINDYYFGLRIFPGQDPSSVYVGWVTPQYHSYVSSFKNSQAV
RSCKFASIEFGSDGLTMPQELIEFRNCYLLNAGELLTCVNDTTNTKVTGVLIGCVIDTSA
GELSFYVEGQDTGRKFRLEAGLMLYPAAFVIPTSSEVCQFELGRVRYTWPLSAALFKSSA
KSLIPYCPPRLSVQVLTPYHWARVPNECLRTTSLKLSDTRGWSVLCNDPVRVMLVHIPEK
NKSYDILELIEMPELLTFHRQTLNLYCKLASHGNQKVSHILCQHVDEDQIMYAIKNHYLS
GSMRQGFHDFLIACYLKSHTDAIQSTSHEYVLPLVPELMVKDIFSDDADCRYPHILGKSL
CIRPVVKSDPPVKSFTKDSQVKLLPPAFNFRALKNYVMSAFGEAMHHAVMNCRDLIGGNN
LDHFEPLFKLFDHLLIMGLFSDDELIEILRIIHPAAFDENYKPGTKLKGILDIDVAEGVK
LQIVNILDHLCDIQLRNRIESLISFSEGFVGELQQDQCARYMDIKQTDMPPAEAARKTKE
FRCPPNEQMYRLLGCKKKEDKEGMLLDDDVEYDQCPMAETLQDQLRDFCSLLVTKCGCND
VEEDVGKIEEIIDLDEETSWVDSLAHLVVSVPPNAVDDEEVVAKQGTKNFRNMIVQLLKQ
WATDNIIESNELIRRMFALLLRQYNGIRELMDSMNQTYVFHERNVEDVQIFITFLMQIRE
LLTVQFETTEEVILKRALWQLMNNRIFFQHPDLMRLLKVHENVMSIMMNVLTAQQNTVEI
ERDPDDPVSSSPIKDASEMVVACSRFLCYFCRTSRQNQKAMFEHLSFLLDNATMLLARPS
LRGSVPLDVAYSSFMDNNELALALKEEELDKVTVYLSRCGLQPNSELIAKGYPDIGWDPL
EGERYIDFLRFCVWINGENVEENANLVIRLLIRRPECLGVALKGEGQGLFSAFQEAIILS
EDINELENGITVDFLRSPIFKDHPHYPSKETEGDDYVDLGASILDFYSSLVDLLAKCAPD
PMTIQEGKGDSVRARAILRSLISLDDLGKILALRFKIPNLRSVLDGMFIPTVVLSQVNSP
TNLATIADNLTKQKLLSLCNDNNNPMHDDLLRNAKSLNVIYENEEDSGESSYDTATESIS
SSPVRRAKSQAKRLRRKKIMRLREFDIEENLDFIKMAKNRRRRSGISLLFNNAGPQPGLM
PSHKASVLLFLDRVYGIDSQEMLFSFMEQSFLPDLRAATMMDSPKATESDTALALNRYLC
NCVLPLLTNHSHFFSDAEHHSALLDATLHTVYRMNRLQSLTKNQRDAVSDFLVAITRELP
PPMMIKLLRKVIIDIQEMKDNVLVPLRIMTLHYERCNKYYGSGNQYGVANETEKRLSMLL
FYAIFDSLGSKPYDPELFGKALPCLTAIGSAISPDYSLTSGSEDTELAKVKDNEGSWCAE
CIKSLLAWGYIIEVYDFDAAEKSAQNHVISGTCIADFNPKPVDLSNMNLEKDMMSAAEKI
AENSHNIWCKKIFSEISGKPSSLPPALVPWDLLTDFERRKNRFHAAEILKFLQYHGYRVN
MSRSNTPAKERTKIEGERGNVEKRFAYNLLEKLIQYLEQASYKMKSVKPSQELTRRNSFK
KEGQDVKFFEKVVLPMMHAYFNAHKNYFLESSIMVQTGTASNKEKEMVASLFCRLAALLR
IKNHAFGSVAKITVKCLQGLTQALDLRTLVKINSDIIRTGLYTFFNNCADDLLAAVNELK
NNGQYSLLRGQNLKSWISLEFANQMIIPCLTTMFHHLARNHFGADLLLDDIQAACYKILD
SLYMVTEIQTSYESRATILHEVEKHRPSLGQCLSAFASTFPVAFLEPEFNQNNKYSVLAK
SADQSVQVQEMLQNLSSHIPTLEKLMERIEQIAQNSIPYNQAPNVYDVDLPLACAYLTFW
WNMGDDGPNSSQNSLPITRANSEYMNRIFCSLLAMIRDHIGSENAQWLCRVTYFAVPIIQ
HVTCDPVKEYLLPIAEKLCTAAELSYKEEERMRTHPDDADEGTVGEDNAKLVRDVYAFFP
ILMKYTDLHRAKWLKNPSWESDRIYENVAVIFKIWSFSQIFKREELNYMAQFEEDQMNAG
GEMKTGKAAIAERKKKRREGFVKKDKHANSIVIACLKRLLPVGLNVFGGRELDIVQQSKE
KFLNKENEEKIREFIRGLSEIPVKTDPTDKNAWQLSLYTKIGKSQMRGKDLMNQDAVVEK
IANMGQVVAILHTSDHPSAAHHCSWKKMLSSQRKRAVVACFRMVPLYGIPRHRGINFFLP
AFSKLWLEEEDLGQDKLVQDLCADCEEVESSAVARLFDDEGVLIGDENAEVVANIAPDPL
SQLIQCFQRAATTEESQALVIASDDLYVNFAQVMAKSVHIEEEDDDGGDDDGEVDQAQKE
EMAQTLRAEQAVLADRGAAIMCLMYISASNGEPSEMVAKTLKLGIHLLSGGNTVIQKMLI
DYLQLKKDVRFFTSIAGLMNNCSVLNLEMFERQIKAEGLGMGAELAAGENQNLNDAEFTC
DLFRFLQLTCEGHNLDFQNYLRTQPGHTTSVNLINCIVDYLLRLQESVMDFYWHYSSKEM
IDEGGKEYFLRAIQVCSQVFNTLTESIQGPCVGNQMTLANSRLWDAINGFFFLFAHMMEK
LYKNSTQLELLREFLNLQKDMIVLMLSMLEGNVLNGAIGKQMVDALVESQQCVEMILKFS
DMFLKLKDLTTSQAFQDFDTNKDGWISPKEFQKAMESQKMYSVEEITYLMMCTDVNNDGK
VDYMEFTERFHNPARDIGFNLAVLLTNLKEHITSDPRLEKIIEKASTLLEYFDPYLGRIE
IMGSSKRVEKIYFEIQESWLEQWSKQQIRDSKNAFLFNVLQDDGGDQGKLEAFINFCEDT
IFEMQHAAEISSGDASDSKMERALKQRDYFLRQTTAGTELTKTMQAGYSIGVNAAAALKP
ENLQKSFHHVSGKVHSMTWFQLIFSILQFCFFFLKEGFLIIFTIVATICRFLYYMTLSGK
EDDIQKPNDLKQDRRTHIPKTNMFTKDLPDFKFETHHEYDAFGVHIPHEDHSSTNKMFPD
GTPPPDPAPSIHIPTDDTLHTPENKSTPSPSPNYFPTPPNGSVHETQSNLGSITYLPPLS
PQEQGPILSNYEPKIAEIAAARSRGSILNMLARNFKTIEKMTLYLAFFINVILLFHRVDI
THQNEETGNEVEVVETGDDDENEGGDEFIYITGLSVPYISYEITGWVLSQILYWLSVFHA
FCSFALLISFYQLKIPLITFKREKEVARKLMFDGCWITEDNTEEQGLMDTVTWYLDRIVI
VSKSFPMKYWDKFVRRKTKAKYKDQVDEETLNKLLGEERAPGDTSFDYRYNCWLWFGVIL
TNAQFLYRVGYLICSTCGVVISPFFYAFHLIDVVLSFPMLKAILQSVTHNLQQLILTIMM
TLVVVYLYTVLAFNFFRKFYVQEGEEGEEPDRKCHNMLTCFIYHFYAGVRAGGGIADEIE
SPYGDELEYPRMLYDISFFFFVIIILLAIMQGLIIDAFGELRDQQEAATEKLESSCFICD
IGKEAFDRMPRGFEIHTTKEHNFANYLFFLQHLVNKDETEYTGQETYVREKYDNRDWEFF
PVGECFMKQYEDQLLQS
Download sequence
Identical sequences A0A0N5BIM7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]