SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0N5CRT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N5CRT3
Domain Number 1 Region: 262-460
Classification Level Classification E-value
Superfamily MIR domain 1.13e-44
Family MIR domain 0.0000143
Further Details:      
 
Domain Number 2 Region: 462-632
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 4.45e-44
Family IP3 receptor type 1 binding core, domain 2 0.000011
Further Details:      
 
Domain Number 3 Region: 124-198
Classification Level Classification E-value
Superfamily MIR domain 0.00000000667
Family MIR domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N5CRT3
Sequence length 659
Comment (tr|A0A0N5CRT3|A0A0N5CRT3_THECL) Uncharacterized protein {ECO:0000313|WBParaSite:TCLT_0000293301-mRNA-1} KW=Complete proteome; Reference proteome OX=103827 OS=Thelazia callipaeda (Oriental eyeworm) (Parasitic nematode). GN= OC=Spiruromorpha; Thelazioidea; Thelaziidae; Thelazia.
Sequence
MSSAAMSVDAFHDTSLHIGDVISLYAEERGRCSEDRSEERCTPRIGFLSTLGLVDDRCIV
EIGIGTPDSPPKKFRVNRYAAQKQFWTEHKKFFMGESLFEEELLKKLKVAADKEKEQNDM
EYKKMLGVSVRYGGTIQLLHVKSDKYVTVLKNSPARQERNAMKVYLDKNGNEGSWFYVEP
VYKHSFLGDNVNAGDRISLVPYSHGPMAKSIGHIKPQLHLSHFNLPDHPSGNEVNCLNEP
TGWQVLMFLQFDENEKTVVKSGDVVRLFHAEQQTFLTLDTEPKKNKDVVFLRLTNRPSAA
DATSSRALWEVQVVQTDSYRGAPASWLEKFRFKHLATDMYLSVEQINSDNTIILTLKAVA
EAEYGADKKYCLVPKSSDQPEVDESLLFVLDPCTFTKMDSRIPQRTYVRLLHLCTNTWIH
TTDPTEKQNLYHFNKNEKGWVKVISEGFKIDKETFALLPVPPDEVRDLDFANDACKALHS
FVELIKSGNIISKEPMNVTIQLITECIYFVTNQLNHMVDPIKIVDFKPLRDRQKLLREQG
VLDQIFALLRVPFLSRNGNDSKPLLDSPRMLSDRGNEVLKRIFQLCYSLLRYSQVGYRKN
QEHLAENFGQIQEQIGFDLLAEDTMTAVLHNNSKLLEKYVKNPHVERFVKLVRDNKSGR
Download sequence
Identical sequences A0A0N5CRT3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]