SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N7H7P7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N7H7P7
Domain Number 1 Region: 3-81
Classification Level Classification E-value
Superfamily Barstar-related 0.000000000000497
Family Barstar-related 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0N7H7P7
Sequence length 92
Comment (tr|A0A0N7H7P7|A0A0N7H7P7_MYCFO) Ribonuclease inhibitor {ECO:0000313|EMBL:OBF87129.1} KW=Complete proteome OX=1766 OS=Mycobacterium fortuitum. GN=A5751_07900 OC=Mycobacterium; Mycobacterium fortuitum complex.
Sequence
MKTYRVDGSKVSSKADFFAELGRAVNGDDGYFGSNLDALADCLRGGFGTPDNRKFRFVMT
SYRDIKEALGQETWSTVLSIFANEGVDLWLEN
Download sequence
Identical sequences A0A0A1FN30 A0A0N7H7P7 A0A100WWW5 K0V958
WP_003883750.1.13746 WP_003883750.1.18888 WP_003883750.1.21576 WP_003883750.1.2631 WP_003883750.1.32870 WP_003883750.1.37265 WP_003883750.1.38301 WP_003883750.1.45471 WP_003883750.1.61762 WP_003883750.1.66199 WP_003883750.1.68251 WP_003883750.1.76167 WP_003883750.1.76975 WP_003883750.1.77100 WP_003883750.1.8092 WP_003883750.1.88140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]