SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0N7ZR60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N7ZR60
Domain Number 1 Region: 135-304
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 7.32e-49
Family IP3 receptor type 1 binding core, domain 2 0.000000601
Further Details:      
 
Domain Number 2 Region: 961-1098
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 8.11e-33
Family IP3 receptor type 1 binding core, domain 2 0.0057
Further Details:      
 
Domain Number 3 Region: 7-132
Classification Level Classification E-value
Superfamily MIR domain 6.8e-32
Family MIR domain 0.00000333
Further Details:      
 
Domain Number 4 Region: 792-839,1049-1149,1338-1383,1469-1543,1595-1641,1790-1874
Classification Level Classification E-value
Superfamily ARM repeat 0.00000115
Family MIF4G domain-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N7ZR60
Sequence length 2382
Comment (tr|A0A0N7ZR60|A0A0N7ZR60_9CRUS) Inositol 1,4,5-trisphosphate receptor type {ECO:0000313|EMBL:JAJ02745.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MTHAVVVPWNSLFRFKHLATGQYLAAEVDDDTAVDGMRSKLRDSNNGPVYHLVPVPHANE
IASIFELDPTTLTRADSLVPQSSFVRLRHLCTNTWVHSTAIPIDKDEEKPVMSKVGSAII
KEDKEAFALVPVPAIEVRDLDFANDACKVLVGVSARLEKGTISQNERRSITSLLQDIIYF
IANGEADQNKSDALELQVTVTNRDRQKLLREQSILKQLFKILQTPFLEPSKDSEGPWLRL
DELQDPKNAPYKYIFRLCYRIFRLSFQDYRKNQEYIAKHFGFMQKQIGYDILAEDTITAL
LHNNRKLLEKHITAAEIETFVGLVRKNMRQWEWRFLDYLSDLCLSNKVAIPVTQELICKS
VLSPENSDILLDTRMLLTPQEMEMDPDSFNYEDDDVILIWGRQQTTRKLADLALRARGGG
VEEQAILDYYRHQLDLFSNMCLDRQYLAINRLSEHLGIDLILKSMADEALPYELRASFCR
LLLHMHVDRDPQEPVTPVKYARLWSEIPKQLSIEDYDNKLPEHENKEAVHQKFNSTMMFV
EDYLCNLVHKAWSLQCKDQNKLTFEVVKLARELIYFGFYSFSDLLRLTRTLLNILDSASS
PGDAEYYHKNNQGPSGQNQQQSNGSSNSQELDTPDGGGVLRSLGDMGAVMTSLALGTAGF
AKSPMPLSLRKKQAQAALKKEDPLVMDTKLKIIEILQFIMNMRLDYRISCLLSIFRREFD
ESSPSGPTSGNDTPKLLEKRIDLESISLKAESIFDNHHTKIHIGVMENSENDDDDGAFCD
LDLDGQGGKTFLRVLLLLTMHDSPPLVSGALRLLFRHFSQRHEVLQAFKQVQLLVSDSDV
ESYKQIKADLDGLRLLVEKSELWVYKAKMATAEDEVSSPAINGGGDEKKVVIKKEPADLL
DEEGGQGQPDSLLLDNNNSIIQHHPLPPNKKPAVRGPMLSTSDKQGSAIDLDIGPPLDES
QAINYKQIQQILARMNRLCVQPVLTTASSVGSQGGSVGGGSGSGSGGGSNSNLRPRKHEQ
RLLRNMGVHTVVLDLLQIPYDRKEDVRMNELMRLAHEFLQNFCRGNQPNQALLHKHLELF
LTPGLLEAQTVCAIFQDNAQLCSELSDKVIQHFVHCIETHGRHVEYLHFLQTIVKAEGQF
IRKCQDMVMQELVNVGEDVLVFYNDKASFNAFVDMMRAERHRLDATDSSGALKYHIELVR
LLALCTMGKNVYTEIKCHSLLTLDDIVAMVSHKDCIPEVKEVYINFLNHCYIDTEVEVKE
IYTSSHMWSLFERSFLVDMARCASATHDRKHADTALEHYVTSSAVSVVTTFFRSPFSDQS
TAVQTRQPVFVQLLQIAFRLSQCAWLSSSQRHNVESCIRTLSDMARSRSIAIPSDLDNQV
TSLFNKPTLHLGASKASKIFRSSRLQSAQLSRESSQSQLSVRFDRTIIEGLQDIVVLLEA
QLHPLVQAESSVIVDVLYRPEYLFQPGTEARKKCDNGGFIRRLIKHTERLLEDKEEKLCI
QVLNTLRQMMNFDVHNGEKGDALRKNLLLRYFAKPTTTSSKKAEHAGPSGGSTTAGTHSM
LGGSGGGQSMLTTHGPGGRLLSRGEMSLHEVQVYLDREGASDLVAELVMKSSLSPNVFME
AVQLGIALLEGGNPVIQRSLYTKLQSAETSAVFFKVFHDKVRESQAEIRSTMSVNTAEMA
SAGNHKLHDAAADHSKDNYSYDVKMRNQRMMSTRASNGNVAASERMDSYGYDPWNNSRSD
DSTTTTMLSSVNSTLEDLVRQQQQPKLIAMDSDVESKLSAKVLVMLPVFRFLQLLCENHN
RDLQNFLRAQSNKNSYNLVSETLMFLDCICGSTTGELGLLGLYINEHNVALINQTLETLT
EYCQGPCHENQNCIATHESNGLDIITALLLTDINPLGQRRMDLVLELKNNASKLLLAVME
SRGDSENAERILYNMNPRQLVDVACKAYHQKLVGGDEAASPKEVGHNIYILCHQLAQHNK
ELASLMKPQLVDGTSGDVALQYYANHTAQIEIVRHDRTMEQIVFPIPEMCEYLTNDTKVR
VFHTAERDDQGSKVAAFFEGVDDMFDEMKWQKKLRGQPLLFWVSSHMSIWSQILFNLAVI
INLIVAFFYPFDTDGPAPDPGTHLSGLIWAVMLLSAAVAITLPKPSGIRTLVMTVILRLI
CSAGPQPTLMLLGTATVALKGIHLLSIMGNAGTFQRSVRQICTDTEIVYHVVYLIFCFLG
LSTHPFFFSVLLFDVVYREETLLNVIRSVTRNGRSIVLTAVLALILVYMFSIIGYIFFKD
DFLVEVDDDPVTAVVPGTCSSDGLDCPSRSTNPFMSQIEEKGEGNGGDNRERACDSLIMC
IVTTLNQGLRNGGGIGDILRAPSSKVKIHYKCIHSWDVLIVM
Download sequence
Identical sequences A0A0N7ZR60

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]