SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N8BDW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N8BDW6
Domain Number 1 Region: 95-223
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 7.32e-27
Family V-type ATPase subunit E 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N8BDW6
Sequence length 232
Comment (tr|A0A0N8BDW6|A0A0N8BDW6_9CRUS) V-type proton ATPase subunit E {ECO:0000313|EMBL:JAK64394.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
LNLLLLSFIKFHNLKTLLLDQTSFFDIELFFSLSVDFLDFFIGFLFDKGRLVQQQRLKIM
EFYERKEKQVELQKKIQSSNLLNQARLKVLQAQQQHIQNLLAESRTRLAKSSADRSNYTR
VICDLIIQALFQIMEPVVTIRCRQVDLELVESVLPEAIAKYSEAMHKPCQINIAKENFLP
VDTCGGVELAAFHGRIRVNNTLENRLEMIAGQMLPEMRTKLFNANPNRKFFD
Download sequence
Identical sequences A0A0N8BDW6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]