SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0N8EDX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N8EDX2
Domain Number 1 Region: 147-316
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 5.49e-49
Family IP3 receptor type 1 binding core, domain 2 0.000000601
Further Details:      
 
Domain Number 2 Region: 975-1112
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 6.54e-33
Family IP3 receptor type 1 binding core, domain 2 0.0057
Further Details:      
 
Domain Number 3 Region: 18-144
Classification Level Classification E-value
Superfamily MIR domain 2.62e-32
Family MIR domain 0.0000028
Further Details:      
 
Domain Number 4 Region: 803-851,1063-1163,1352-1397,1483-1557,1609-1655,1804-1877
Classification Level Classification E-value
Superfamily ARM repeat 0.0000273
Family MIF4G domain-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0N8EDX2
Sequence length 1914
Comment (tr|A0A0N8EDX2|A0A0N8EDX2_9CRUS) Putative Inositol 1,4,5-trisphosphate receptor type {ECO:0000313|EMBL:JAN58445.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MPWXXXXXXXXXXXXXXAGHWNSLFRFKHLATGQYLAAEVDDDTAVDGMRSKLRDSNNGP
VYHLVPVPHANEIASIFELDPTTLTRADSLVPQSSFVRLRHLCTNTWVHSTAIPIDKDEE
KPVMSKVGSAIIKEDKEAFALVPVPAIEVRDLDFANDACKVLVGVSARLEKGTISQNERR
SITSLLQDIIYFIANGEADQNKSDALELQVTVTNRDRQKLLREQSILKQLFKILQTPFLE
PSKDSEGPWLRLDELQDPKNAPYKYIFRLCYRIFRLSFQDYRKNQEYIAKHFGFMQKQIG
YDILAEDTITALLHNNRKLLEKHITAAEIETFVGLVRKNMRQWEWRFLDYLSDLCLSNKV
AIPVTQELICKSVLSPENSDILLDTRMLLTPQEMEMDPDSFNYEDDDVILIWGRQQTTRK
LADLALRARGGGVEEQAILDYYRHQLDLFSNMCLDRQYLAINRLSEHLGIDLILKSMADE
ALPYELRASFCRLLLHMHVDRDPQEPVTPVKYARLWSEIPKQLSIEDYDNKLPEHENKEA
VHQKFNSTMMFVEDYLCNLVHKAWSLQCKDQNKLTFEVVKLARELIYFGFYSFSDLLRLT
RTLLNILDSASSPGDAEYYHKNNQGPSGQNQQQSNGSSNSQELDTPDGGGVLRSLGDMGA
VMTSLALGTAGFAKSPMPLSLRKKQAQAALKKEDPLVMDTKLKIIEILQFIMNMRLDYRI
SCLLSIFRREFDESSPSGPTSGNDTPKLLEKRIDLESISLKAESIFDNHHTKIHIGVMEN
SENDDDDGAFCDLDLDGQGGKTFLRVLLLLTMHDSPPLVSGALRLLFRHFSQRHEVLQAF
KQVQLLVSDSDVESYKQIKADLDGLRLLVEKSELWVYKAKMATAEDEVSSPAINGGGDEK
KVVIKKEPADLLDEEGGQGQPDSDSLLLDNNNSIIQHHPLPPNKKPAVRGPMLSTSDKQG
SAIDLDIGPPLDESQAINYKQIQQILARMNRLCVQPVLTTASSVGSQGGSVGGGSGSGSG
GGSNSNLRPRKHEQRLLRNMGVHTVVLDLLQIPYDRKEDVRMNELMRLAHEFLQNFCRGN
QPNQALLHKHLELFLTPGLLEAQTVCAIFQDNAQLCSELSDKVIQHFVHCIETHGRHVEY
LHFLQTIVKAEGQFIRKCQDMVMQELVNVGEDVLVFYNDKASFNAFVDMMRAERHRLDAT
DSSGALKYHIELVRLLALCTMGKNVYTEIKCHSLLTLDDIVAMVSHKDCIPEVKEVYINF
LNHCYIDTEVEVKEIYTSSHMWSLFERSFLVDMARCASATHDRKHADTALEHYVTSSAVS
VVTTFFRSPFSDQSTAVQTRQPVFVQLLQIAFRLSQCAWLSSSQRHNVESCIRTLSDMAR
SRSIAIPSDLDNQVTSLFNKPTLHLGASKASKIFRSSRLQSAQLSRESSQSQLSVRFDRT
IIEGLQDIVVLLEAQLHPLVQAESSVIVDVLYRPEYLFQPGTEARKKCDNGGFIRRLIKH
TERLLEDKEEKLCIQVLNTLRQMMNFDVHNGEKGDALRKNLLLRYFAKPTTTSSKKAEHA
GPSGGSTTAGTHSMLGGSGGGQSMLTTHGPGGRLLSRGEMSLHEVQVYLDREGASDLVAE
LVMKSSLSPNVFMEAVQLGIALLEGGNPVIQRSLYTKLQSAETSAVFFKVFHDKVRESQA
EIRSTMSVNTAEMASAGNHKLHDAAADHSKDNYSYDVKMRNQRMMSTRASNGNVAASERM
DSYGYDPWNNSRSDDSTTTTMLSSVNSTLEDLVRQQQQPKLIAMDSDVESKLSAKVLVML
PVFRFLQLLCENHNRDLQNFLRAQSNKNSYNLVSETLMFLDCICGSTTGELGLLGLYINE
HNVALINQTLETLTEYCXXXXXXXLVTKTRIASPLTSRTVSTSSRPSSSQTLIR
Download sequence
Identical sequences A0A0N8EDX2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]