SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N9UAH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N9UAH6
Domain Number 1 Region: 36-115
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.000000000106
Family Crystallins/Ca-binding development proteins 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0N9UAH6
Sequence length 204
Comment (tr|A0A0N9UAH6|A0A0N9UAH6_SPHMC) Uncharacterized protein {ECO:0000313|EMBL:ALH82393.1} KW=Complete proteome; Reference proteome OX=33050 OS=Sphingopyxis macrogoltabida (Sphingomonas macrogoltabidus). GN=AN936_19150 OC=Sphingomonadaceae; Sphingopyxis.
Sequence
MRLSFPWKAAAGIILIAGSGMLTTSTAQIPDERRYRPPEATIYRDAAYRGPAVFIGEAKS
NLGLAWPVNSIRVASGRWELCEKTRYRGTCRTVERDTPMLGNVLRGLTIQSIRPVGSGGG
GWNPNPPANDQVVRGNFAEFHTQPGTGGYRVLACASGSSTANCAARTADSWCRSVGWNGS
AREHMETVANRVYLADVLCVRSGY
Download sequence
Identical sequences A0A0N9UAH6
WP_084758539.1.22181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]