SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0P0QM31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P0QM31
Domain Number 1 Region: 221-398
Classification Level Classification E-value
Superfamily MIR domain 1.44e-38
Family MIR domain 0.0028
Further Details:      
 
Domain Number 2 Region: 1092-1220
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.21e-21
Family SPRY domain 0.037
Further Details:      
 
Domain Number 3 Region: 4223-4282
Classification Level Classification E-value
Superfamily EF-hand 0.0000000238
Family Polcalcin 0.038
Further Details:      
 
Domain Number 4 Region: 104-188
Classification Level Classification E-value
Superfamily MIR domain 0.0000000366
Family MIR domain 0.019
Further Details:      
 
Domain Number 5 Region: 671-806
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000368
Family SPRY domain 0.07
Further Details:      
 
Domain Number 6 Region: 2274-2357
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000157
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P0QM31
Sequence length 5140
Comment (tr|A0A0P0QM31|A0A0P0QM31_SPOEX) Ryanodine receptor {ECO:0000313|EMBL:ALL55464.1} OX=7107 OS=Spodoptera exigua (Beet armyworm) (Noctua fulgens). GN=RyR OC=Noctuoidea; Noctuidae; Amphipyrinae; Spodoptera.
Sequence
MAEAEGGASEQDDVSFLRTEDMVCLSCTATGERVCLAAEGFGNRHCFLENIADKNIPPDL
SQCVFVIEQALSVRALQELVTAAGSETGKENLGKGTGSGHRTLLYGNAILLRHLNSDMYL
ACLSTSSSQDKLAFDVGLQEHSQGEACWWTLHPASKQRSEGEKVRVGDDLILVSVATERY
LHTTKENEVSIVNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPST
WTKDGGQNIVVYEGGSVMSQARSLWRLELARTKWAGGFINWYHPMRIRHITTGRYLGVND
QNELYLVSREEATTASCAFCLRQEKDDQKQVLEDKDLEVIGAPIIKYGDSTVIVQHSETG
LWLSYKSYETKKKGVGKVEEKQAILHEEGKMDDGLDFSRSQEEESRTARVIRKCSSLFTK
FINGLETLQENRRHSMFFASVNLGEMVMCLEDLINYFAQPDEDMEHEEKQNKFRALRNRQ
DLFQEEGILNLILEAIDKINVITSQGFLAGFLAGDKSGQNWEMISGYLYQLLAAIIKGNH
TNCAQFANSNRLNWLISRLGSQASGEGTGMLDVLHCVLIDSPEALNMMRDGHIKVIISLL
EKHGRDPKVVDVLCSLCVGNGVAVRSSHINICDYLLPGKNLLQQTALVDHVSSVSPNIVV
GRVEGCAVYRKWYSEVTMDHIEKTTHMMPHLRIGWANTTGYVPYPGGGDKWGGTGVGGDS
YSYGFDGAYLWSGGRKTQVNRTHAEEPYIRKGDVIGCALDLTGRLINFMFNGVRVTGSFT
NFNLEGMFFPVISCSSKLSCRFLLGGEHGRLRYAAPEGYSPLVESLLPQQILSLEPCFYF
GNLAKRALAGPPLVQDDTAFVPTPVDTLQIPLPSYVEQIRDKLAENIHEMWAMNKIEAGW
MYGDQRDDLHKIHPCLVPFERLPPAEKRYDIQLAVQTLKTILALGYYISLYKPPARIRNV
RLPNEPFMQSNGYKPAPLDLSAVTLTPKMDELVDQLAENTHNLWARERIQQGWTYGLNED
PDMHRSPHLVPYPKVDDAIKKANRDTASETVRTLLVYGYNLDPPTGEQHEALLLEASKQK
QAEFRTYRAEKNYAVGSGKWYFEFEILTAGPMRVGWAHADMAPGMMLGQDENSWAFDGYN
EEKVYSGSTESFGKQWSVGDVVGVFLDLIDKTISFSLNGELLMDALGGETTFADVQGDNF
VPACTLGVGQKARLTYGQDVNTLKYFTTCGLQEGYEPFCVNMKRDVTHWYTKDQPIFENT
DEMIDTRIDVTRIPAGSDTPPCLKISHNTFETMEKANWEFLRLSLPVICHNEFIDEAEKA
RRWVEIKERQQILMKEAVEAQMPAHIDQIMRSGFTMNDIKGLHYEDNQEEVPSSKVKRQP
SRPPRKGSMTRGVSIQNYNNLQPGQVNGMHRSTSEAEMAKYDLGAHNLSPDDKKDKRGRS
PFKFFKTNRGESIDRAKSPKSHTPHPFGDTEVSPERGPRRPNPQIKVSQANHRYNAMTPR
PTPTNLNGRQVALTSTAPMATPTQDRKQMTTSTLAQSTTETVGNEIFDGECLKLINEYFY
GVRIFPGQDPTHVYIGWVTTQYHLHSKDFNQSKVTKSSVIITDDYDRIVENVNRQSCYMV
RADELYNEVMAEATAKGASQGMFIGCSVDTSTGTVSFTCEGKDTSFKFKMEPETKLFPAI
FVEATSKDILQIELGRSTTSLPLSAAVLPTSDKHVIPQFPPRLKVQCLKPHQWARVPNQS
LQVHALKLSDIRGWSMLCEDAVSMLALHIPEEDRCIDILELIEMDKLLSFHSHTLTLYAA
LCYQSNYRAAHALCTHVDQKQLLYAIQSQYMSGPLRQGFYDLLIALHLESHATTMEACKN
EFVIPLGPELKSLYEDPEMGHSLRSLQTESVRPQMKMTDIAESITDISNLYSPYFPLEVV
REFVMQALAEAVETNQVHNRDPVGGSNENLFLPLIKLVDRLLLVGMMRDEDVEKLLIMTN
PETWDPSFDKEGKDEHRKGLLHMKMAEGAKLQMCYLLQHLNDIQLRHRVEAIIAFAHDFV
GDLQTDQLRRYTEIKQSDLPSAVAAKKTREFRCPPREQMNAILSFKHLEEEDKENCPCGE
ELIARMNEFHESLMAHVSLHALQEPDGTENQEPEAKPGAFGKLYNIINTVKELEEEPKAI
DEPPKKTPEEKFRKVLIQTIVNWAEESQIETPKLVREMFSLLVRQYDAVGELIRALEKTY
VINAKTKLDVAEMWVGLSQIRALLPVQMSQEEEELMRKRLWKLVNNHTFFQHPDLIRVLR
VHENVMAVMMNTLGRRAQAQSDAQPASPPVAEDSKEKDTSHEMVVACCRFLCYFCRTGRQ
NQKAMFDHFDFLLENSNILLSRPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAVYL
SRCGLQSNSELVEKGYPDLGWDPVEGERYLDFLRFCVWVNGESVEENANLVIRLLIRRPE
CLGPALRGEGEGLLKAIVDANKMSERIADRRKLREMEQEGDVSFSHPLPESDDDEDYIDT
GAAILNFYCTLVDLLGRCAPDAGVIALGKNESLRARAILRSLVPLEDLQGVLSLRFTLNN
PAAGEERPKSDMPSGLIPGHKQSVGLFLERVYGIETQELFYKLLEEAFLPDLRAATMLDR
NDGCESDMALSMNRYIGNSILPLLIKHAYFYNEAENYASLLDATLHTVYRLSKNRMLTKG
QREAVSDFLVALTSAMQPSMLLKLLRKLTVDVSKLSEYTTVALRLLTLHYERCAKYYGST
GAGQGVYGASSDEEKRLTMMLFSNIFDSLSKMDYEPELFGKALPCLIAIGCALPPDYSLS
KNYDDEFYGKEQVAGDLDNPQYDPQPINTSSVALNNDLNTIVQKFSEHYHDAWASRKIEN
GWVYGEGWSDSQKTHPRLKPYNMLNDYEKERYKEPVRESLKALLAIGWSVEHSEVDIPST
NRSSMRRQSKSGGRPPDLVMDSATLFNYIPHSVDMTNLTLSREMQNMAERLADNAHDIWA
KKKKEELVTNGGGIHPQLVPYDLLTDKEKKKDRERSQEFLKYLQYQGYKLHRPSKAPQSD
TEQTTTGVAIELRFAYSLLEKLIQYIDRATINMKLLKPSTTFSRRTSFKTSTRDIKFFSK
VVLPLMEKYFSTHRNYFIAVATATNNVGAASLKEKEMVAALFCKLASLLRSRLAAFGPDV
RITVRCLQVLVKGIDAKSLVKNCPEFIRTSMLTFFNNVADDVGHTIMNLQDGKYAHLRGT
HLKTSTSLGYINGVLLPILTAKFDHLANCEYGADLLLDEIQVASYKMLGSLYALGTDASL
THDRKYLKTEIERHKPALGSCLGAFSSTFPVAFLEPHLNKHNQFSLLNRIADHSLEAQDI
MQKMEQCMPTLETILGEVDQFVESDKTYNEAPHIIDVVLPLLCSYLPFWWAQGPDNVTPT
GGNHVTMVTAEHMNQLLKNVLKLIKKNIGNENAPWMTRIATYTQQIIINSSEELLRDSFL
PLAERVRKRTDNMFHKEESLRGFIKSSTDDASQVESQIQEDWQLLVRDIYSFYPLLIKYV
DLQRNHWLRNNVPEAEELYNHVAEIFNIWSKSQYFLKEEQNFISANEIDNMVLIMPTATR
RVTAVVDGTPQAGGKKKKKHRDKKRDKDKEVQASLMVACLKRLLPVGLNLFAGREQELVQ
HCKDRFLKVGTLKKMSEQDVAEFAKTQLTLPDKIDPADEMSWQHYLYSKLGSKSKTNITV
ETAENKAKIIDDTVERIVAMSKVLFGLHMIDHPQQMSKNVYRSVVSIQRKRAVIACFRQT
SLHSLPRHRACNIFARTYYELWLEEENVGQEVMIEDLTQSFEDAELKKSDGEEEGEKPDP
LTQLVTTFCRGAMTERSGALQEDPLYMSYAHIIAKSCGEEEEEGGGEEEEGGGEAEAEDE
GRASIHEQEMEKQKLLFHQARLANRGVAEMVLLHISASKGLPSEMVMKTLQLGISILRGG
NIDIQMGMLNHLKDKKDVGFFTSIAGLMNSCSVLDLDAFERNTKAEGLGVGLEGAAGEKN
MHDAEFTCALFRFIQLTCEGHNLDWQNYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFY
WHYSSKELIDPAGKANFFKAIGVASQVFNTLTEVIQGPCTQNQQALAHSRLWDAVGGFLF
LFSHMQDKLSKHSSQVDLLKELLNLQKDMITMMLSMLEGNVVNGTIGKQMVDTLVESASN
VELILKYFDMFLKLKDLTSSASFQEIDANNDGWVLPKDFKEKMEQQKSYTPEEIEFLLAC
CETNHDGKLDYIGFCDRFHEPAKEIGFNLAVLLTNLSEHMPNEPRLARFLETAGSVLNYF
EPFLGRIEIMGGSKRIERVYFEIKESNIEQWEKPQIKESKRAFFYSIVTEGGDKEKLEAF
VNFCEDAIFEMTHASGLMAASEESVGGTKNREASYMYMGDDDDERAGKDPFRRGLQSVKD
GIYAAFSSLSPSNIKAKIADLQQMPPAELAVGFFKMFFLLLYYLGYGMLVVIRYIFGVIL
GLMRGPQTDEPPPEPTEEEKIGQLRHRLLATQSSRHLPALPPADDTGQIQVSAFGLDITK
EDNGQIQVKPHESPSTSTPSSGEEAEVSPDESADHPEEQRPPSLIDLLGGEQAKKQAQER
MEAQAAQQAAMSAIEAESKKAVQVPAPSALSQVDLSQYTRRAVSFLARNFYNLKYVALVL
AFCINFVLLFYKVSTLDAEGGEGSGLGDIIARSGSGSGSGSGDGGSGESEDDDALEVVHI
DEDFFYMEHVIKVAAVLHSIVSLAILIGYYHLKVPLAIFKREKEIARKLEFDGLYIAEQP
EDDDLKSHWDKLVISAKSFPVNYWDKFVKKKVRAKYSETYDFDSISNMLGMEKTSFSAQE
EEGSKGLIHYIINIDWRYQVWKAGVTITDNSFLYSLWYFSFSVMGNFNNFFFAAHLLDVA
VGFKTLRTILQSVTHNGKQLVLTVMLLTIIVYIYTVIAFNFFRKFYVQEEDDEVNRNCHD
MLTCFVFNLYKGVRAGGGIGDELEPPDGDDSEVYRIIFDITFFFFIIVILLAILQGLIID
AFGELRDQLESVKEDMESNCFICGINKDYFDKVPHGFDTHVQREHNLANYMFFLMHLINK
PDTEYTGQETYVWNMYTQRCWDFFPVGDCFRKQYEDLMGE
Download sequence
Identical sequences A0A0P0QM31

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]