SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P1GJK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P1GJK0
Domain Number 1 Region: 16-124
Classification Level Classification E-value
Superfamily HisI-like 6.8e-49
Family HisI-like 0.000042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P1GJK0
Sequence length 131
Comment (tr|A0A0P1GJK0|A0A0P1GJK0_9RHOB) Phosphoribosyl-AMP cyclohydrolase {ECO:0000256|HAMAP-Rule:MF_01021, ECO:0000256|SAAS:SAAS00976554} KW=Complete proteome; Reference proteome OX=928856 OS=Tropicibacter multivorans. GN=TRM7557_03777 OC=Rhodobacteraceae; Tropicibacter.
Sequence
MKEQKVFAMENATKFDVSSLKYNEAGLVPCIAQDHKSGEILMMAWMNAESIEKTLETGEV
TYWSRSRQAFWVKGKTSGHVQHLVDFRVDCDRDALLALVTQKGPACHTNRRSCFYTAVRA
GDEVELMKPMV
Download sequence
Identical sequences A0A0P1GJK0
WP_058291749.1.29640 WP_058291749.1.36711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]