SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P1N0P3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P1N0P3
Domain Number 1 Region: 38-100
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000432
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P1N0P3
Sequence length 249
Comment (tr|A0A0P1N0P3|A0A0P1N0P3_9BACT) Serine/threonine protein kinase {ECO:0000313|EMBL:CUS86028.1} KW=Complete proteome; Reference proteome OX=1633631 OS=Candidatus Kryptonium thompsoni. GN=JGI15_100128 OC=Bacteria; Candidatus Kryptonia; Candidatus Kryptonium.
Sequence
MKKQRLKKLFIIAAVFVLFVLAMDKAVMPFYVNSVKSIEMPNLIGKKLEEAKQIIDSLNL
KLENVTERHDARFPAGYVIIQNPRPQMKIKEGRRVYLVVSSGEQKVEVPSLIGKSVREAK
LTLEKFGLRLGAVEYDFSEDFPEGAIFSQSIPEKAKVSIGTPVSVVVSLGDAEGKTQVPN
LIGIPLSKVERILNEAGLRIGKIVYEPSSTVLPNTVIEQFPRPGFFVAKGSSVDIFVAKE
LSEMQKQNY
Download sequence
Identical sequences A0A0P1N0P3
WP_047134496.1.30963 WP_047134496.1.38481 WP_047134496.1.64062 WP_047134496.1.82624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]