SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P4V1M1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P4V1M1
Domain Number 1 Region: 8-122
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.0000824
Family HEPN domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P4V1M1
Sequence length 124
Comment (tr|A0A0P4V1M1|A0A0P4V1M1_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:GAP98606.1} KW=Complete proteome; Reference proteome OX=1552121 OS=Leptolyngbya sp. NIES-2104. GN=NIES2104_51610 OC=Leptolyngbya.
Sequence
MIPEQQKFLDKADRSLQAAQVLQQQGLSDFAISRAYYAMFYAAQALLVERGLSFSTHAGV
LSAFGKQFVRSGEVPKEFHQALITAEHARIQGDYDIDQELTQADAIEQIQQAEAFLEMAK
SRLG
Download sequence
Identical sequences A0A0P4V1M1
WP_059000667.1.54409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]