SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P4VFA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P4VFA2
Domain Number 1 Region: 54-267
Classification Level Classification E-value
Superfamily BEACH domain 6.93e-67
Family BEACH domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P4VFA2
Sequence length 267
Comment (tr|A0A0P4VFA2|A0A0P4VFA2_9HEMI) Putative lysosomal trafficking regulator lyst {ECO:0000313|EMBL:JAI52555.1} OX=72488 OS=Rhodnius neglectus. GN= OC=Panheteroptera; Cimicomorpha; Reduviidae; Triatominae; Rhodnius.
Sequence
LVLGNINLSDIYIGQDLWIQVLPCLTDNIHSAPGQIIRTETEIPPHQDTDGAAELGRLTE
AWAYRALSNFDYLCELNRLAGRREGDPRSHYVLPWVTDFSCRSGANWRDLTKSKFRLNKG
DRQLDLTYDLPSNATQAQIPHHVPDVLSEITYYVYLARVTPKTVLCKYVRPQWVPAEYPA
SIQRLQAWSPDECIPEFFTSPSVFKSIHSDLCDLEVPPWCSSPNEFIAKHRAALESQHVS
ERLHHWIDLTFGYKLSGIAAVKSKNVC
Download sequence
Identical sequences A0A0P4VFA2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]