SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0P4W5Q7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P4W5Q7
Domain Number 1 Region: 238-424
Classification Level Classification E-value
Superfamily MIR domain 7.41e-60
Family MIR domain 0.0000001
Further Details:      
 
Domain Number 2 Region: 427-597
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 8.11e-50
Family IP3 receptor type 1 binding core, domain 2 0.000000907
Further Details:      
 
Domain Number 3 Region: 109-214
Classification Level Classification E-value
Superfamily MIR domain 2.35e-18
Family MIR domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P4W5Q7
Sequence length 937
Comment (tr|A0A0P4W5Q7|A0A0P4W5Q7_9EUCA) Uncharacterized protein {ECO:0000313|EMBL:JAI63925.1} OX=85551 OS=Scylla olivacea (orange mud crab). GN= OC=Eubrachyura; Portunoidea; Portunidae; Scylla.
Sequence
MGPEGSASFLHMGDHVSLYAEGSVSGFISTLGLVDDRCVVNPEAGDLTNPPKKFRDCLFC
IYPSNRYSAQKQFWNAAKQSGNSATDSSLLERLHHAAETEKKQNEAESKKLMGTIINYGN
TIQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDANGNEGSWFYINPYYKLRNPGDRVVVG
DKVILSPVNAGQQLHVSSTHDLRDHPGCKEVNVLNSNTCWKISLFLEHRENIEGILKGGN
VIRLFHAEQEKFLTMDEYKKKQNVFLRTTGRTTATAATSSKALWEVEVVQHDPTRGGAGH
WNSLFRFKHLATGHYLAAEVDEDPTPDPTREKLRDPSGGHVYQLVSVPLSNDIASIFELE
PTTQIRFDSMVPQSSYVRLRHLCTYTWVHSTSIPIDKEEDKPVMSKVGCAAIKEDKEAFS
LVPVHAKEVRDLDFANDASEVLAKHAKKLEKGTITQTERKSLMQLLIELVYFTAEKEHEQ
TKNENLALALEVTNPNRDRQKLLREQSILKQIFKILQAPFTEYQGGDGPLLRIDELNDPR
HSAYKTIFRLCYRLLRLAQQNYRKNQEHIAQHFGFMQKQIGIDILAEETITALLHNNRKL
LEIHITATEIETFVGLVRKNMHKWDWRFLDYLKVLCISNNQAIPRTQELICKSVFSEKNK
DILIETRVIEEMEMQNELDASSTLLPIEDGEDEVILLWNNGERSKSIVELAARAQNQNES
EGGEDRLILEYYRHMLDLFSNMCLDRQYLAIKPLSPLLKINLMLKCMEEETLTYDLRAAF
CRLMLHMHVDCEPQEMVTPVKYARLWSEIQSHMSISDYDKHAAVHSAEAAETTFKDVISF
VEEYLCNVVDKMWSFSDCEQNKLTFEVVKLARYLIYFGFYSFSDLLRLTKTLLSILDYSF
DTESKYFPGSLSQAVMRSAPQNCKLHPVQSSYTSAIR
Download sequence
Identical sequences A0A0P4W5Q7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]