SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0P4XSD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P4XSD3
Domain Number 1 Region: 243-429
Classification Level Classification E-value
Superfamily MIR domain 1.74e-60
Family MIR domain 0.0000000568
Further Details:      
 
Domain Number 2 Region: 432-601
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 9.02e-49
Family IP3 receptor type 1 binding core, domain 2 0.000000601
Further Details:      
 
Domain Number 3 Region: 1258-1395
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.02e-32
Family IP3 receptor type 1 binding core, domain 2 0.0057
Further Details:      
 
Domain Number 4 Region: 113-225
Classification Level Classification E-value
Superfamily MIR domain 0.0000000000000051
Family MIR domain 0.014
Further Details:      
 
Domain Number 5 Region: 1086-1136,1346-1446,1635-1680,1766-1840,1892-1938,2087-2171
Classification Level Classification E-value
Superfamily ARM repeat 0.0000587
Family MIF4G domain-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P4XSD3
Sequence length 2846
Comment (tr|A0A0P4XSD3|A0A0P4XSD3_9CRUS) Inositol 1,4,5-trisphosphate receptor type {ECO:0000313|EMBL:JAI84995.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MMGELLGSGSFLHLGDIVSLFAEGSVSAFLSTLGLVDDRCVVNPEAGDLTNPPKKFRDCL
FKICPMNRYSSQKQFWKAAKQSSAGGGSGDASLLKRLHHAAEIEKKQNETENKKVMGSLV
RYGSVVQLLHLKSNKFLTVNKRLPALLEKNAMRVSLDPSGNEGSWFYILPFYKLRSTGDT
VVLGDKVILNPVNGGSQVLHVAANHELPDNPGCKEVNVVNSTTPWKISLFMEHRENLDDV
LKGGDVVRLFHAEQEKFLTMDEHKKKQHVFLRTTGRVSATSATSSKALWEVEVVQHDPCR
GGAGHWNSLFRFKHLATGQYLAAEVDDDTAVDGMRSKLRDSNNGPVYHLVPVPHANEIAS
IFELDPTTLTRADSLVPQSSFVRLRHLCTNTWVHSTAIPIDKDEEKPVMSKVGSAIIKED
KEAFALVPVPAIEVRDLDFANDACKVLVGVSARLEKGTISQNERRSITSLLQDIIYFIAN
GEADQNKSDALELQVTVTNRDRQKLLREQSILKQLFKILQTPFLEPSKDSEGPWLRLDEL
QDPKNAPYKYIFRLCYRIFRLSFQDYRKNQEYIAKHFGFMQKQIGYDILAEDTITALLHN
NRKLLEKHITAAEIETFVGLVRKNMRQWEWRFLDYLSDLCLSNKVAIPVTQELICKSVLS
PENSDILLDTRMLLTPQEMEMDPDSFNYEDDDVILIWGRQQTTRKLADLALRARGGGVEE
QAILDYYRHQLDLFSNMCLDRQYLAINRLSEHLGIDLILKSMADEALPYELRASFCRLLL
HMHVDRDPQEPVTPVKYARLWSEIPKQLSIEDYDNKLPEHENKEAVHQKFNSTMMFVEDY
LCNLVHKAWSLQCKDQNKLTFEVVKLARELIYFGFYSFSDLLRLTRTLLNILDSASSPGD
AEYYHKNNQGPSGQNQQQSNGSSNSQELDTPDGGGVLRSLGDMGAVMTSLALGTAGFAKS
PMPLSLRKKQAQAALKKEDPLVMDTKLKIIEILQFIMNMRLDYRISCLLSIFRREFDESS
PSGPTSGNDTPKLLEKRIDLESISLKAESIFDNHHTKIHIGVMENSENDDDDGAFCDLDL
DGQGGKTFLRVLLLLTMHDSPPLVSGALRLLFRHFSQRHEVLQAFKQVQLLVSDSDVESY
KQIKADLDGLRLLVEKSELWVYKAKMATAEDEVSSPAINGGGDEKKVVIKKEPADLLDEE
GGQGQPDSLLLDNNNSIIQHHPLPPNKKPAVRGPMLSTSDKQGSAIDLDIGPPLDESQAI
NYKQIQQILARMNRLCVQPVLTTASSVGSQGGSVGGGSGSGSGGGSNSNLRPRKHEQRLL
RNMGVHTVVLDLLQIPYDRKEDVRMNELMRLAHEFLQNFCRGNQPNQALLHKHLELFLTP
GLLEAQTVCAIFQDNAQLCSELSDKVIQHFVHCIETHGRHVEYLHFLQTIVKAEGQFIRK
CQDMVMQELVNVGEDVLVFYNDKASFNAFVDMMRAERHRLDATDSSGALKYHIELVRLLA
LCTMGKNVYTEIKCHSLLTLDDIVAMVSHKDCIPEVKEVYINFLNHCYIDTEVEVKEIYT
SSHMWSLFERSFLVDMARCASATHDRKHADTALEHYVTSSAVSVVTTFFRSPFSDQSTAV
QTRQPVFVQLLQIAFRLSQCAWLSSSQRHNVESCIRTLSDMARSRSIAIPSDLDNQVTSL
FNKPTLHLGASKASKIFRSSRLQSAQLSRESSQSQLSVRFDRTIIEGLQDIVVLLEAQLH
PLVQAESSVIVDVLYRPEYLFQPGTEARKKCDNGGFIRRLIKHTERLLEDKEEKLCIQVL
NTLRQMMNFDVHNGEKGDALRKNLLLRYFAKPTTTSSKKAEHAGPSGGSTTAGTHSMLGG
SGGGQSMLTTHGPGGRLLSRGEMSLHEVQVYLDREGASDLVAELVMKSSLSPNVFMEAVQ
LGIALLEGGNPVIQRSLYTKLQSAETSAVFFKVFHDKVRESQAEIRSTMSVNTAEMASAG
NHKLHDAAADHSKDNYSYDVKMRNQRMMSTRASNGNVAASERMDSYGYDPWNNSRSDDST
TTTMLSSVNSTLEDLVRQQQQPKLIAMDSDVESKLSAKVLVMLPVFRFLQLLCENHNRDL
QNFLRAQSNKNSYNLVSETLMFLDCICGSTTGELGLLGLYINEHNVALINQTLETLTEYC
QGPCHENQNCIATHESNGLDIITALLLTDINPLGQRRMDLVLELKNNASKLLLAVMESRG
DSENAERILYNMNPRQLVDVACKAYHQKLVGGDEAASPKEVGHNIYILCHQLAQHNKELA
SLMKPQLVDGTSGDVALQYYANHTAQIEIVRHDRTMEQIVFPIPEMCEYLTNDTKVRVFH
TAERDDQGSKVAAFFEGVDDMFDEMKWQKKLRGQPLLFWVSSHMSIWSQILFNLAVIINL
IVAFFYPFDTDGPAPDPGTHLSGLIWAVMLLSAAVAITLPKPSGIRTLVMTVILRLICSA
GPQPTLMLLGTATVALKGIHLLSIMGNAGTFQRSVRQICTDTEIVYHVVYLIFCFLGLST
HPFFFSVLLFDVVYREETLLNVIRSVTRNGRSIVLTAVLALILVYMFSIIGYIFFKDDFL
VEVDDDPVTAVVPGTCSSDGLDCPSRSTNPFMSQIEEKGEGNGGDNRERACDSLIMCIVT
TLNQGLRNGGGIGDILRAPSSKEPMFGARVIYDMLFFFVVIIIVLNLIFGVIIDTFADLR
SEKQQKEEILKNTCFTCGLDRSQFDNKAVSFEDHIRHEHNMWHYLYFIVLVRVKDPTEFT
GPESYVYAMVKDKNLEWFPRLRAISLAAEGEESEQNELRSLQSQLETTQSLVATLSRQLA
ELRDQVIQLKRQCQILVSNLNLISNI
Download sequence
Identical sequences A0A0P4XSD3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]