SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P5H2L6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P5H2L6
Domain Number 1 Region: 59-214
Classification Level Classification E-value
Superfamily alpha-ketoacid dehydrogenase kinase, N-terminal domain 3.66e-42
Family alpha-ketoacid dehydrogenase kinase, N-terminal domain 0.00000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P5H2L6
Sequence length 253
Comment (tr|A0A0P5H2L6|A0A0P5H2L6_9CRUS) Putative 3-methyl-2-oxobutanoate dehydrogenase [lipoamide] kinase {ECO:0000313|EMBL:JAK18224.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MLSLKHFALTLCKEKRSGCVIRHLTHFASSQSNSIGNNSKTPPQSNPSVSSYYKVNNQSA
IDTAAGKPSVRLTPYMILYSGKSHDGSHLLKSAQYLWKELPVRIAHRIHEFRSLPFIIGC
NPTILEVHELYIRAFNILNNHPAIRTADDEAAYSRLLRDLLDDHTHVVTQLAAGFKECRK
HIQNEDVVRQFCDRTLTSRLGIRLLVTHHLSLREEKVFSPSYLLNFITFFQLITFMQNLC
SLIMSASSINLFD
Download sequence
Identical sequences A0A0P5H2L6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]