SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P5ILB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P5ILB4
Domain Number 1 Region: 66-305
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 9.29e-89
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.00000135
Further Details:      
 
Domain Number 2 Region: 1-50
Classification Level Classification E-value
Superfamily SNARE-like 0.00000000000000151
Family Clathrin coat assembly domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P5ILB4
Sequence length 311
Comment (tr|A0A0P5ILB4|A0A0P5ILB4_9CRUS) AP-1 complex subunit mu-1 {ECO:0000313|EMBL:JAK39116.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MSEYFKEIEEESIRDNFVIVFELLDEMSDFGYPQTTESKILQEYITQEGHKLETAPRPPP
AVTNAVSWRSEGIKYRKNEVFLDVIESVNLLASTTGNVLRSEIVGSIKMRVYLSGMPELR
LGLNDKVLFESTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNT
HVKPLIWIESVIERHAHSRVEYMIKARSQFKRRSTANHVEVVVPVPADADSPKFKTSVGS
VKYVPEQNVLIWSIKSFPGGKEYLMRAHFGLPSVLSEETEGKPPIQVKFEIPYFTTSGIQ
VKNIKRHLSAP
Download sequence
Identical sequences A0A0P5ILB4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]