SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P5PRP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P5PRP1
Domain Number 1 Region: 46-108
Classification Level Classification E-value
Superfamily BEACH domain 0.0000916
Family BEACH domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P5PRP1
Sequence length 139
Comment (tr|A0A0P5PRP1|A0A0P5PRP1_9CRUS) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial {ECO:0000313|EMBL:JAL16577.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
RLAAYWNKDWKPGPYPKTDAERIAAAIKYGLLPQDYEPYPDDGLGYGYYPKLPIVSADMK
DSLYNWDYPEMKRDFGEPMNTQYDVFTEERLSNARTRFSAKFTLASFLGVMGGFLTLHLL
CEYNDWYLRHPWVRVGIMF
Download sequence
Identical sequences A0A0P5PRP1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]