SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P5UB45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P5UB45
Domain Number 1 Region: 53-99
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 1.75e-16
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00034
Further Details:      
 
Domain Number 2 Region: 102-153
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 0.00000000000000141
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P5UB45
Sequence length 161
Comment (tr|A0A0P5UB45|A0A0P5UB45_9CRUS) Transcription initiation factor IIA subunit {ECO:0000313|EMBL:JAL86550.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
SCIWRRLALHRCNDLLCFVKLNKLPDIVSYLLSVPLSDPQEFELFISLFEIMAYQLYRNT
TLGNTLQETLDELIQFGQITPQLALKVLVHFDRTMNNSLALKVKNRLTFKAGKLNTYRFC
DNVWTFLLSDVEFRDVSELCKGETVKIVACDGKAVPPTKDD
Download sequence
Identical sequences A0A0P5UB45

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]