SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0P6F7D1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P6F7D1
Domain Number 1 Region: 215-392
Classification Level Classification E-value
Superfamily MIR domain 1.66e-36
Family MIR domain 0.0031
Further Details:      
 
Domain Number 2 Region: 1085-1212
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-23
Family SPRY domain 0.021
Further Details:      
 
Domain Number 3 Region: 4233-4297
Classification Level Classification E-value
Superfamily EF-hand 0.000000000175
Family Polcalcin 0.095
Further Details:      
 
Domain Number 4 Region: 664-799
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000514
Family SPRY domain 0.058
Further Details:      
 
Domain Number 5 Region: 98-181
Classification Level Classification E-value
Superfamily MIR domain 0.0000000353
Family MIR domain 0.019
Further Details:      
 
Domain Number 6 Region: 2267-2355
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000111
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 
Domain Number 7 Region: 1552-1676
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000384
Family SPRY domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P6F7D1
Sequence length 5197
Comment (tr|A0A0P6F7D1|A0A0P6F7D1_9CRUS) Ryanodine receptor 44F {ECO:0000313|EMBL:JAN43000.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MADKESGSEQDDVSFLRTEDNVCLSCTATGERVCLAAEGFGNRHCFLENIADKNAPPDLS
QCVFVIEQALSVRALQELVTAASSESGTGTGSGHRTLLYGNAVLLRHLNSNMYLACLSTS
SSNDKLAFDVGLQEQSQGEACWWTLHPASKQRSEGEKVRVGDDLILVSVATERYLHTTKE
KDVSIVNASFHVTHWSVAPFGTGLSRVKNVGFLFGGEVLRFFHGGDECLTIPSSWSEQPG
QNIVVYEGGDVVLQARSLWRLELARTKWAGGFINWLHPMRIRHITTGRYLCINENKDLCL
LPRNQANLAVSAFYLRKEKDDEKKILEDKDLEVLGSPIIKYGDSTVIVQHVETGLWLSYK
AFETKKKGVGKVEEKQAVLHEEGKMDDGLEFSRSQEEESRTARVIRKCSSLFNRFITGLD
ALANDHQHMTFFENVNLGEMVKCLEDLIDYFAQPEENIEHEEKQLKLRALRNRQDLFQEE
GILNLILDAIDKLTTITGQGYMVALAGEAAGQNLESISAYLYQLLAAIIRGNHTNCAQFA
QSHRLNWLFSRLGSQASGEGTGMLDVLHCILIDSPEALNMMREEHIKVIISLLEKHGRDP
KVLDVLCSLCVGNGVAVRSSQNNIADYLLPGRNLLLQTQLVDHVSSIRPNIYVGKVVNSA
VFLKWYFELTVDHVEVTTHLMPHLRVGWAKLPGYVAYPGGGEKWGGNGVGDDLYSYGFDG
AQLWTGGRSTVVHAGMTEPYIRKGDVIGCALDLTVPIMNFYLNGVKVKGNFKNMNLDGMF
FPVVSCSARVSCRFLFGGEHGRLRFPSPYGFSPLYECLLPTQTLALDPCFHFGDLTKSTL
AGPLEVLNDTAFVPQPVDTSMIALPAYIETIRDRLAENIHEIWAMNKIEEGWVFGERRDD
LHKIHPCLTPFERLPPAEKRYDTQLALQTLKTILALGYHITMDKPPSRIKTVRLPNDPFA
QSNGYKPAPLDLANITLSGKLEELIDQLAENTHNVWAKERITQGWTYGLNEDPDNKRSPH
LVPYSNVDDIIKKANRDTASETVRTLLVYGYVLEPPTGEPHETAVVSGSVGSKNPEYRTY
RAEKTYAVTSGKWYFEFEVLTSGPMRVGWARADAKAGYQLGQDDCSWAFDGWREEKFYLG
TGESFGKQWSAGDCVGVFLDLVDRTVSFSLNGDLLMDSMGSETAFTDIQGEEFIPAFTLG
VGQRARLVFGQDVNALKYFTSCGLQEGYEPFCVNMSRQMTYWYTRDQPIFENNDDFADSP
IEVTRIPGGSDSPPCMKISHKEFETMEKANWEFLRLSLPVTFHDSFISEQEKVRRWQEIR
LRQNRLRADNVTRNATLEQSMLKSGFTMSDINELQYGYDSEEQRRGQQAGNRPPVPERHG
RLRSIDYNTNGHDVNGHASDTSPSKGILRATSELPIGRQARENDRKARTPDVSGESKEDK
KKRGKSPFAFFTRLRDASTERRNKAKTPEPGIASRDAPQKPETSRTKNVASKNVNNVRLA
PNDLKVIPPAIPDRRPSRQGSSPMIQPRGILGGEGEDFDPLDVECMRLINEYFYGVRIFP
GQDPTHVYVGWVTTNFHLQDKTFDQSKDRKVLVSRVDDADRVLESVDRHSCYMLRADELY
NEVTQDVASKGASQGMFIGCFIDTATGWISFTCEGKETKHRYKMEVGTKLFPAIFVEATS
KEVLQFELGRTPTTLPLSAAVLQNSEKHVVPQFPPRLKVQILKPHQWSRVPNQSLKVHAL
KLSDLRGWSMLCEDPVSMLAVHIPEEDRCIDVLELIEHERLLSFHAHTLQLYSALCFQSN
FRAAHTLCSYVDQKQLLYAIQSEYLSGPLRAGFSDLLIALHIESHAKTMEVTQNEYIIPM
SNELRELYSDPEMTHSLSSLRVESIRPQMTTTDIQEHIETIKDLSTPYFPLEVVKVFAIH
ALQLAVQLNQVHNRDPIGGSNENLFVPLLKLIDKLLLVGIMEDDDIPPLLMLIDPETWDP
TFDPLGKDEHRKGLLQMPLAEGVKLQMCCLLHHLLDNQLRHRVEAIVNFSHDFVGEIQSD
QLRRYIEIKQSDLPSAIAAKKTREFRCPPVQQMNAILGFKNLPEEERENCPCNEELAQIQ
TGFHESFTSKLLHKMAEEELTPEEPPKEETKHGLVNRMMTAITLAKKNEEEVIAKENVKS
REQIFRKVLIKTIISWAEESVIESYKLVREMFRLLLRQYDGIGEAMRALQKTYVINSRTT
KDVQELWIGLSRIRGLLPVQMSQEEEELMRELLWKMVNNHSFFQHPDLMRNLRVHENVMA
IMMNTLGRRAQAQSDAQTQAQVQASGGEELMPKEKDTSHEMVVACCRFLCYFCRTSRANQ
KTMFEHLSFLLENSNILLSRPSLRGSTPLDVAYSSVMDNTELALALREHYLEKIAIYLSR
CGLQSNTELMERGYPDLGWDPVEGERYLDFLRFCVWVNGESVEENANLVIRLLIRRPECL
GPALRGEGDGLLTAITDANKMSERIQIQKALHSGTGALTIPGLNHPMPQGDDDEDFIDIG
AAILSFYCTLVDLLGRCAPAEAVIAQGKNESLRARAILRSLVPLEDLEGVLSLRFTLQNH
GSEEGASDLPSGLIPGHKQSVVIFLERVYGIEDIELFFRLLEEAFLPDLRAATILEKTDG
GESDMALALNRYIGNSILPLLITHSRFYAEAENHASVLDATLHTVYRLSKNKMLTKGQRE
AVSDFLVALTRELQPNMLLKLLRKLTVDVSRLSEYTTVALRLLTLHYERCGKYYGAVGGQ
GSYGSASDEEKRLTMMLFSNIFDSLSKMEYDPELFGKALPCLTAIGCALPPDYALATNME
DEWYKSAPSDSNGPYDPQPINTTKVSLNTELTNLVQKFSEHYHDAWAKRKIENGWNFGDA
WSDETKSHPRLKPPHMLTDYERERYREPIRDSLKALLALGWSIEFADYDAANSNRNSMRR
SSTDGGTTPYNYNPNPVDMANLTLSREMQNMAERLAENSHDIWAKKKKEEMASSGGGLHP
QMVPYDLLTDKEKRKDRERTQELLKYLQFMGYKLHSPGPTSFSRMGKSQIQQNPDAVALE
GETTSSSDRRFAYSLLEKLIQYLDIAAFNMKHLRPSTNYSRRSSFKTSTRDVKFFSKVVL
PLMEKYFSTHRHYFISVATATSSIGAASMKEKEMVASLFCKLASLLRYKFSAFGSDTRIA
VRCLQVLVRATDAKSLVKNCYEFIRTSMLMFFNNAADDLSQCLSNLYEMKYNLLRGTHLK
TSSSLTYVQMVLLPVLTALFDHLSVYEFGSDLLLDDIQVACYKILNNLYTFGTDSSVYKD
RKFIKIEIDRHRPSIGSCLGAFASTFPVAFLEPHLNNHNPGSCLGAFASTFPVAFLEPHL
NNHNPFCIHGKLQESSLEAQDVMSKLESSMPTLETLLAQVEQYVASEKAYAEAPHVIDVM
LPMLCSYLPFWWGQGPDNQDPVGGNHITMVTSDHMNQLLKNVLNLIKAHIGSELAPWMTR
IAGFTQQIIINTSEELLKDPFLPLAQKIRKRTEQMFHKEETLRGFLKSTTEDTSQVEGQL
QSDWYLLVRDIYAFYPLLIKYVDLQRNHWLRHDVAEGEELYAHVAEIFNMWSNSQYFGKE
EQNFISANEIDNMTLIMPTSASRKATVVTDQTPAGASGKVKKKKSRDRKRDKDKEIAASL
MVACLKRLLPVGLNLFPGREQELVQHCKDRFLKKVVEREIVDFAKTQLTLPDKIDPSDAM
SWQHYLYSKLGSKKPSPAITGATDSSKKNANHQAILDELVERIVAMAKVLYGLHMIDHPQ
QQQKDAWRSVVSSQRKRAVIACFQQKSLHSLPRHKAINIFLRTYQELWLADENVGQEVII
EDLTQSFEDAELKKKDVQEEEGKPDPLLQLVTTFNRGATTERAGTTFEDELYMAYAVIMS
KSCGEEEEEEEEGGDEEGGASIHEQEMEKQKLLFHQSRLASRGVYEMVLQFISAAKGAQS
DMVMNTLELGISILRGGNVDIQMQMLNYLKEKKDAGFFTSIAGLMNSCSVLDLDAFERNT
KAEGLGVGAEGAAGEKNMHDAEFTCVLFRFIQLTCEGHNLEWQNYLRTQAGNTTTVNVVI
CTVDYLLRLQESIMDFYWHYSSKEIIDPAGKANFLKAIGVASQVFNTLSEVIQGPCTLNQ
QALAHSRLWDAVGGFLFLFANMQDKLSKHSSQLDLLKELLNLQKDMVIMMLSMLEGNVVN
GTIGKQMVDTLVESASNVELILKYFDMFLKLKDLTGSAAFQESETTKDGWITPKEFREKM
EAFKSYSVEEMDFMLSCCDTNHDGKIDYIEFTERFHNPAKEIGFNLAVLLTNLSEHMPSD
PRLQRFLETAGSVLNYFESFLGRIEIMGSSKTMERVYFEINESNIEQWEKPQIKESKRAF
FYSIVTEGDKEKLEAFVNFCEDAIFEMQHASGLMASDEEGGHSQARQAAYKLPTDEEEQG
PMDIVRQKLKGFKDTIVFGLSKLSPSNIRKQMRELKHKTYPELFVGFFKLIFWMFYYTGY
SGVYVIKHFFRILLSLMRGPQPEKLPEKPATEETTMLILRPPPAPAILPPDTNPEIPPVT
TVALVGAIPDGVAKDQTTDGATAPVGSTDPSQPDATGTVPVGGEAQPAPAGATPASLFVG
TLIDPVEEAAKAAAAAEVQAQQEATMAALDEAKASSAAHVAASPVGQVNIGEYVRKAICF
LARNFYTLKYVALVLAFCINFVLLFYKASNIIEANADDEAAGDAAPDARSAGGLADLAES
IADAVENATTEIFNATQNIVEAIMEGGEEGEGGEGDDGDGDDEEAEEYIHVDERFSYLAS
VLRGMAVLHSVISLFMLIAYYHLKVPLAIFKREKEIARRLEFDGLYIAEQPEENDMRAYW
DKLVISAKSFPVNYWDKFVKKKVRQKYSETYDFDAISNLLGMEKSSLSQEEEPPSGFVNS
LLSVDWRYQVWKAGVTITDNSFLYSLWYFSFSILGNYNYFFFAAHLLDVAVAIASLRTIL
QSVTHNGKQLLLTVMLLTIIVYLYTVIAFNFFRKFYVQEEDDNVDKKCHDMLTCFVFHIY
KGVRAGGGIGDEIESPDGDEYEVYRIMFDITFFFFIIVILLAIIQGLIIDAFGELRDQLA
SVSENLESECFICGIGKDYFDSVPHGFDTHVQKEHNLANYLFFLMHLINKPDTEYTGQET
YVWNMYQQRCWDFFPVGDCFRKQYEAELGGGESEKKG
Download sequence
Identical sequences A0A0P6F7D1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]