SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0P6J5U4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P6J5U4
Domain Number 1 Region: 237-431
Classification Level Classification E-value
Superfamily MIR domain 1.4e-63
Family MIR domain 0.0000000857
Further Details:      
 
Domain Number 2 Region: 433-599
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 7.45e-55
Family IP3 receptor type 1 binding core, domain 2 0.000000337
Further Details:      
 
Domain Number 3 Region: 1110-1260
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 3.79e-31
Family IP3 receptor type 1 binding core, domain 2 0.0076
Further Details:      
 
Domain Number 4 Region: 109-219
Classification Level Classification E-value
Superfamily MIR domain 1.16e-18
Family MIR domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P6J5U4
Sequence length 2658
Comment (tr|A0A0P6J5U4|A0A0P6J5U4_HETGA) Inositol 1,4,5-trisphosphate receptor type 3 {ECO:0000313|EMBL:JAN97960.1} OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=ITPR3 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MSEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVC
PMNRYSAQKQYWKAKQSKQDKEKIADVVLLQKLQHAAQMERKQNDTENKKAHGDVVKYGG
VIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVG
DKVILNPVNAGQPLHASNYELSDNAGCKEVNSVNCNTSWKINLFMQFCDHLEEVLKGGDV
VRLFHAEQEKFLTCDEYKGKLQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHW
NGLYRFKHLATGNYLAAEENPSYKGDAPDPKAAGAGRAGRRNAGEKIKYRLVAVPHGSDI
ASLFELDPTTLQKTDSLVPRNSYVRLRHLCTNTWIQSTNVPIDADEERPIRLMLGTCPTK
EDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNEGFISQNDRRFVIQLLEDLVFFV
SDVPNNGQNVLDIMVAKPNRERQKLMREQNILKQIFGILKAPFRDKGGEGPLVRLEELSD
QKNAPYQHMFRLCYRVLRHSQDDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLHNNR
KLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPKNSD
ILIQTELRPVKEMAQSHEYLSIEYSEEEVWLTWTDKNNEHHEKSVRQLAQEARAGNAHDE
NVLSYYRYQLKLFARMCLDRQYLAIDEISQQLGVDLIFLCMADEMLPFDLRASFCHLMLH
VHVDRDPQELVTPVKFARLWTEVPTAITIKDYDSNLNASRDDKKNKFASTMEFVEDYLNN
VVSEAVPFANEEKNMLTYEVVSLAHNLIYFGFYSFSELLRLTRTLLAIIDCVQGPSAMLQ
GYEDPGGKNVRRSIQGVGHMMTTMVLSRKPSVAGPGVPEPLDRSKFEDKEHIVVMETKLK
VLDILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSATANLNLDRIGE
QAEAMFGVGKTSSMLEVDDEGGRMFLRVLVHLAMHNYAPLVSGALQLLFKHFSQRQEAMH
TFKQVQLLISAQDVENYKVIKLELDRLRTMVEKSELWVEKKGSSKGEVGEAAEAGAAKDR
KERPTAEEAPGEKGSENYQIVRGILERLNKMCGVGEQMRKKQQRLLKNMDAHKVMLDLLQ
VPYDKGDAKMLEILRLTHQFLQKFCAGNPGNQALLHKHLHLFLTPGLLEAETMQHIFLNN
YQLCSEVGEPVLQHFVHLLATHGRHVQYLDFLHTVIKAEGKYVKKCQDMIMTELTNAGDD
VVVFYNDKASLAHLLDMMKTARDGVEDHSPLMYHISLVDLLAACAEGKNVYTEIKCTSLL
PLEDVVSVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTLFESFTLDMARV
CNRREKRLADPALEKYVLTVVLDTISAFFSSPFSENSTSLQTHQTIVVQLLQSTTRLLEC
PWLQQQHKGSVEACIRTLAMVAKGRAISLPMDLDAHISALLSSGASSAAAAQRNAASYKT
ATRTFPRLTPATNQWDYKNIIEKLQDIITALEERLKPLVQAELSVLVDVLHWPELLFPEG
SEAYQRCESGGFLSKLIQHSKGLMESEQKLCTKVLRTLQQMLLKRNKYGDRGNQLRKMLL
QNYLQNRKSSSRGELPDPMGTGLDQDCSAIGATQCRLDKEGATKLVCDLITSTKNEKIFQ
ESIGLAIRLLDGGNTEIQKSFYNLMTSDKKSERFFKVLHDRMKRAQQETKSTVAMNMTDL
GSRPREDHELADPTAKGRVTSFSMPGSPYSLGPSLRRGHEASERTQSNEMGTSVLIMQPI
LRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDIMCGSTTGGLGLLGLYINEDN
VGLVTQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALILNDISPLCKYRMDLVLQLK
DNASKLLLALMESRHDSENAERILISLRPQELVDVIKKAYVQEEEHENSEVSPREVGHNI
YILALQLSRHNKQLQHLLKPVRRIQEEEAEGISSMLSLNNKQLSQMLKPSAPALEEEEDP
LAYYENHTSQIEIVRQDRRMEQIVFPVPAICQFLTEETKHRLFTTTEQDEQGSKVSDFFD
QSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGSISFNLAVFINIIIAFFYPYVEGASTGV
LGSPLISLLFWILICFSITALFTKHYSIRPLIVALILRSIYYLGIGPTLNILGTLNLTNK
IVFVVSFVGNRGTFIRGYKAMVMDVEFLYHVGYILTSVLGLFAHELFYSILLFDLVYREE
TLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILQVDRLPGNHSRASPPG
APEGAATFVDTCSGDKMDCVTEVTVPKVLEEDEEPDSTERACDTLLMCIVTVMNHGLRNG
GGVGDILRRPSKDESLFPARVVYDLLFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEI
LKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWSYLHFIVLVRVKNKTDYTGPESYVAQM
IKNKNLDWFPRMRAMSLVSSEGEGEQNEIRILQDKLSSTMKLVSHLTTQLNELKEQMTEQ
RKRRQRLGFVDVQNCMSR
Download sequence
Identical sequences A0A0P6J5U4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]