SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0P6JBQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P6JBQ8
Domain Number 1 Region: 236-420
Classification Level Classification E-value
Superfamily MIR domain 2.62e-67
Family MIR domain 0.00000000724
Further Details:      
 
Domain Number 2 Region: 422-587
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 5.49e-60
Family IP3 receptor type 1 binding core, domain 2 0.0000000192
Further Details:      
 
Domain Number 3 Region: 1118-1274
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 3.92e-37
Family IP3 receptor type 1 binding core, domain 2 0.0065
Further Details:      
 
Domain Number 4 Region: 108-219
Classification Level Classification E-value
Superfamily MIR domain 9.42e-20
Family MIR domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P6JBQ8
Sequence length 2742
Comment (tr|A0A0P6JBQ8|A0A0P6JBQ8_HETGA) Inositol 1,4,5-trisphosphate receptor type 1 isoform 1 {ECO:0000313|EMBL:JAN97961.1} OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=ITPR1 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDTVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDQDASRSKLRNAQEKMVYSLVSVPEGSDISSIFELDPTTL
RGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGTSPVKEDKEAFAIVPV
SPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDLVYFVTGGTNSGQDVL
EVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEELGDQRHAPFRHICRL
CYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLHNNRKLLEKHITAAEI
DTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPTNADILIETKLVLSRF
EFEGVSTGETALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDAKEGQKEDRDVLSYYRY
QLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRASFCRLMLHMHVDRDPQ
EQVTPVKYARLWSEIPSEIAIDDYDSSGASKDEIKERFAQTMEFVEEYLRDVVCQRFPFS
DKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVHVTTIFPISKMAKGEEN
KGNNDVEKLKSSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAAPEGNVKQVEPEKEDIM
VMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSETSSGNSSQEGPSNVPG
ALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGALQLLFRH
FSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGPDEIMDGA
SGENEHKKTEEGNNKSQKHESTSSYNYRVVKEILIRLSKLCVQESASVRKSRKQQQRLLR
NMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQNQALLHKHINLFLNPG
ILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEGKFIKKC
QDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSPLMYHIHLVELLAVCTE
GKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEIYTSNHM
WKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQSTTLQTRQP
VFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAIPVDLDSQVNNLFLKSH
NIVQKTAMNWRLSARNAARRDSVLAASRDYRNIIERLQDIVSALEDRLRPLVQAELSVLV
DVLHRPELLFPENTDARKKCESGGFICKLIKHTKQLLEENEEKLCIKVLQTLREMMTKDR
GYGEKQISIDELDNAELPQAPEPENSTEELEPSPPLRQLEDHKRGEALRQILVNRYYGNV
RPSGRRESLTSFGNGPLSPGGPSKPGGGGGGSGSGSMSRGEMSLAEVQCHLDKEGASNLV
IDLIMNATSDRVFHESILLAIALLEGGNTTIQHSFFCRLTEDKKSEKFFKVFYDRMKLAQ
QEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPLTQITEEVRDQLLEASTATRKAFT
TFRREADPDDHYQPGEGTQATTDKTKDDLEMSAVITIMQPILRFLQLLCENHNRDLQNFL
RCQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVALINQTLESLTEYCQGPC
HENQNCIATHESNGIDIITALILNDINPLGKKRMDLVLELKNNASKLLLAIMESRHDSEN
AERILYNMRPKELVEVIKKAYMQGEVEFEDGENGEDGAASPRNVGHNIYILAHQLARHNK
ELQTMLKPGGQVDGDEALEFYAKHTAQIEIVRLDRTMEQIVFPVPSICEFLTKESKLRIY
YTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPVLYWCARNMSFWSSISFNLAVLMN
LLVAFFYPFKGVRGGTLEPHWSGLLWTAMLISLAIVIALPKPHGIRALIASTILRLIFSV
GLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFTRGYRAMILDVEFLYHLLYLVICAMGLFV
HEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIVGYLFFKDDFI
LEVDRLPNETAVPEIGESLASEFLYSDMCRVESGENCSSPAPKEELVPVEEMEQDKEHTC
ETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIVLNLIFGV
IIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHIKEEHNMWHYLCFIVLV
KVKDSTEYTGPESYVAEMIKERNLDWFPRMRAMSLVSSDSEGEQNELRNLQEKLESTMKL
VTNLSGQLSELKDQMTEQRKQKQRIGLLGHPPHMNVNPQQPA
Download sequence
Identical sequences A0A0P6JBQ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]