SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P6WQJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P6WQJ7
Domain Number 1 Region: 12-145
Classification Level Classification E-value
Superfamily FlgN-like 0.00000000000000706
Family FlgN-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P6WQJ7
Sequence length 177
Comment (tr|A0A0P6WQJ7|A0A0P6WQJ7_9CHLR) Uncharacterized protein {ECO:0000313|EMBL:KPL71081.1} KW=Complete proteome; Reference proteome OX=229920 OS=Leptolinea tardivitalis. GN=ADM99_12445 OC=Leptolinea.
Sequence
MVVQAPKETPQEIMSAIEAVMVNEFRVCQSLLTVLQQERQALVQKDVNALSHLVEQKETL
LDELGSDEESRRSQLEKLAQNCGLKNEVLSLNELLLRLQLTASERVYRLQEGIVALQSKI
RELNRANLALAEMNMERITALQNYLVGLFSSPSYYEASGAATKAGLPPASYGMDHRG
Download sequence
Identical sequences A0A0P6WQJ7
WP_062422821.1.22762 WP_062422821.1.69152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]