SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P6ZNM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P6ZNM3
Domain Number 1 Region: 1-41
Classification Level Classification E-value
Superfamily Ribosomal protein L36 0.0000000000405
Family Ribosomal protein L36 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P6ZNM3
Sequence length 41
Comment (tr|A0A0P6ZNM3|A0A0P6ZNM3_9SPHN) 50S ribosomal protein L36 {ECO:0000256|HAMAP-Rule:MF_00251} KW=Complete proteome; Reference proteome OX=1647104 OS=Citromicrobium sp. RCC1885. GN=AAJ72_14120 OC=Sphingomonadaceae; Citromicrobium.
Sequence
MKIRNSLKSLKNRHRDNRVIRRRGRTYVINKTNKRMKARQG
Download sequence
Identical sequences A0A0P6ZNM3 A0A2D9IE83
WP_010235965.1.1625 WP_010235965.1.19023 WP_010235965.1.31253 WP_010235965.1.31600 WP_010235965.1.49726 WP_010235965.1.59768 WP_010235965.1.59849 WP_010235965.1.83162 WP_010235965.1.87640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]