SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P7DIC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P7DIC3
Domain Number 1 Region: 73-266
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.82e-45
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00021
Further Details:      
 
Domain Number 2 Region: 5-72
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 4.58e-16
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P7DIC3
Sequence length 275
Comment (tr|A0A0P7DIC3|A0A0P7DIC3_PSEPU) Chemotaxis protein methyltransferase {ECO:0000256|PIRNR:PIRNR000410} KW=Complete proteome OX=303 OS=Pseudomonas putida (Arthrobacter siderocapsulatus). GN=HB13667_11695 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSTGNLDFEQFRVFLEKACGILLGENKQYLVSSRLNKLMEQQGIKSLGELVQRIQAQPRG
GLREQVVDAMTTNETLWFRDTYPFEVLKNKVIPEFIRNNPGQRLRMWSAACSSGQEPYSI
SMAIDEFERSNLGQLKMGAQIVATDLSGTMLTNCKTGEYDSLAIARGLSQERLQRYFDTK
GPGRWAVKSAIRSRVEFRSFNLLDSYASLGKFDVVFCRNVLIYFSAQVKKDILLRIHSTL
KPGGYLFLGASEALNGLPDHYQMVQCSPGIIYQAK
Download sequence
Identical sequences A0A0P7DIC3
WP_054572690.1.57632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]