SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P7E668 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P7E668
Domain Number 1 Region: 62-93
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.0000384
Family H-NS histone-like proteins 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P7E668
Sequence length 101
Comment (tr|A0A0P7E668|A0A0P7E668_9GAMM) Histone family protein nucleoid-structuring protein H-NS {ECO:0000313|EMBL:KPM82771.1} KW=Complete proteome OX=570156 OS=Pseudoalteromonas lipolytica. GN=AOG27_14160 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence
MKEIRSFVKSASLSELEKAKQLIDTAIEKYTQQQEAKKEVLDLLKEKGLTLEDLQDVVTT
DKRTKVKPKYRIEFNGEIVEWTGRGKRPKAFQGVDLTKHLA
Download sequence
Identical sequences A0A0P7E668
WP_054553670.1.65788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]