SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P7IMY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P7IMY9
Domain Number 1 Region: 1-181
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 4.45e-50
Family H-NOX domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P7IMY9
Sequence length 181
Comment (tr|A0A0P7IMY9|A0A0P7IMY9_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KPN75773.1} KW=Complete proteome OX=1689868 OS=Shewanella sp. Sh95. GN=AEA42_18065 OC=Shewanellaceae; Shewanella.
Sequence
MKGIIFNVLEDMVVAQCGMSVWNDLLEKHAPKDRVYVSAKSYAESELFSIVQDVAQRLNM
PIQDVVKAFGQFLFNGLASRHASVVEHFEDFTSLVMGIHDVIHLEVNKLYHEPSLPNITG
QHLSDNQIALRYSSPRRLCFCAEGLLFGAAEHFKQKIQITHDTCMHTGADHCMLIIELQN
D
Download sequence
Identical sequences A0A0P7IMY9 A0A1Z4A892
WP_055648449.1.63360 WP_055648449.1.74954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]