SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P7VIW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P7VIW7
Domain Number 1 Region: 114-224
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 0.0000000000023
Family Bcl-2 inhibitors of programmed cell death 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P7VIW7
Sequence length 230
Comment (tr|A0A0P7VIW7|A0A0P7VIW7_9TELE) BH3-interacting domain death agonist-like {ECO:0000313|EMBL:KPP75543.1} KW=Complete proteome; Reference proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=Z043_105194 OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
MAKSGAAAPLLFIFLNVRGCGSEELRRQLCDLGWQQLELQLGLPGAGAGASEEDGELQAD
GHSCSSPFGFEEEHLHLRATSFAVTSPKRQLTWCVRHVCVVLLVPRSPGCVALSGRTGDR
VDPAVLRAVAEELVRIADQLENRVVSRSVERLMERLQGAPNQSWKDYLSEEVMIMLHGSL
GPELNQLPMERMLLALTFTLVKGVCERAPRFLRGLFHAAVQYVDGIPFLH
Download sequence
Identical sequences A0A0P7VIW7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]