SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0P7WKZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P7WKZ9
Domain Number 1 Region: 211-416
Classification Level Classification E-value
Superfamily MIR domain 2.44e-65
Family MIR domain 0.0000000098
Further Details:      
 
Domain Number 2 Region: 419-583
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 9.55e-60
Family IP3 receptor type 1 binding core, domain 2 0.0000000498
Further Details:      
 
Domain Number 3 Region: 82-194
Classification Level Classification E-value
Superfamily MIR domain 1.57e-20
Family MIR domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P7WKZ9
Sequence length 610
Comment (tr|A0A0P7WKZ9|A0A0P7WKZ9_9TELE) Uncharacterized protein {ECO:0000313|EMBL:KPP64428.1} KW=Complete proteome; Reference proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=Z043_117229 OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
CSMKSPYSLSADCLFKLCPMNRYSAQKQFWKAAKPGGNSTTDTVLLNKLHVSGLAAILVT
HGTVSLGSHAADLEKKQNESENRKLLGTVIQYGNVIQLLHLKSNKYLTVNKRLPALLEKN
AMRVTLDSAGNEGSWFYIQPFYKLRSIGDSVVIGDKVVLNPVNAGQPLHASSHQLVDNPG
CNEVNSVNCNTSWKIVLFMKWSDNKETILKGGDVVRLFHAEQEKFLTCDDHRKKQYVFLR
TTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWNSLFRFKHLATGHYLAAEMYLSFQVN
PDYEEESQEPRSSLDLDHEALRARLRTPQEKVMYTLVSVPDGNDISSIFELDPTTLRGGD
SLVPRNSYVRLRHLCTNTWVHSTNNPIDKEEEKPVMLRIGTSAIKEDKEAFAIVPVPPAE
VRDLDFANDASKVLASIAGKLEKGTITQNERRFVTKLLEDLVFFVVDIPNSGQDVLEIMV
NKPNRERQKLMREQNILKQIFKLLQAPFTDSGDGPMLRLEELGDQRHAPFRHICRLCYRV
LRHSQQDYRKNQEYIAKQFRFMQKQIGYDVLAEDTITALLHNNRKLLEKHITAAEIDTFV
SLVRKNREPR
Download sequence
Identical sequences A0A0P7WKZ9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]