SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P7WN31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P7WN31
Domain Number 1 Region: 6-202
Classification Level Classification E-value
Superfamily 14-3-3 protein 4.19e-73
Family 14-3-3 protein 0.0000000774
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P7WN31
Sequence length 216
Comment (tr|A0A0P7WN31|A0A0P7WN31_9TELE) Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide-like {ECO:0000313|EMBL:KPP62477.1} KW=Complete proteome; Reference proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=Z043_119338 OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
MDPATMDKTELVQKAKLAEQAERYDDMASAMKEVTEQGGELSNEERNLLSVAYKNVVGAR
RSSWRVISSIEQKTEGGEKKQQMSREYREKIEKELKEICNDVLGLLDKYLIPKATPAESK
VFYLKMKGDYYRYLAEVAVGEQKNGTLSKKSGEDKRRSRRECGEDAFDEAIAELDSLNED
SYKDSTLIMQLLRDNLTLWTSDSQGETEDAEDGKNN
Download sequence
Identical sequences A0A0P7WN31

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]