SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0P7XMF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P7XMF0
Domain Number 1 Region: 1-246
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.5e-100
Family Capz alpha-1 subunit 0.00000000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P7XMF0
Sequence length 251
Comment (tr|A0A0P7XMF0|A0A0P7XMF0_9TELE) Capping protein (Actin filament) muscle Z-line, alpha 2-like {ECO:0000313|EMBL:KPP77987.1} KW=Complete proteome; Reference proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=Z043_102546 OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
VRLLLNNDNLLREGAAHAFAQYNLDQFTPVKIDGYEEQVLITEHGDLGGGRVLDPKNKIS
FKFDHLRKEASDPRPHDVESSVESWRNAVDAAVRNYVKEHYPSGVCTIYGKTIDGHQTII
VCIECHQFQPKNFWNGRWRSEWKFTVTPSSTQVAGIMKIQVHYYEDGNVQLVSHKEVQEP
MTISNEAQTAKEFIKIMEAAENDYQTAINENYQAMSDTTFKALRRQLPVTRTKIDWNKIL
SYKIGKEMQNA
Download sequence
Identical sequences A0A0P7XMF0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]