SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P8AJH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P8AJH4
Domain Number 1 Region: 17-113
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 9.55e-35
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.00018
Further Details:      
 
Domain Number 2 Region: 114-152
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000399
Family Prokaryotic DksA/TraR C4-type zinc finger 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P8AJH4
Sequence length 155
Comment (tr|A0A0P8AJH4|A0A0P8AJH4_9RHOB) RNA polymerase-binding transcription factor DksA {ECO:0000256|HAMAP-Rule:MF_00926} KW=Complete proteome; Reference proteome OX=1666917 OS=Rhodobacteraceae bacterium HLUCCO18. GN=HLUCCO18_10925 OC=Rhodobacteraceae.
Sequence
MPDQILHAGSGEGSTMKAEVFLPEDYRPAEDEPFMNERQLEYFRRKLLSWKHDLLEESRS
TVETLQDGTRNIPDVADRASEETDRALELRTRDRQRKLIAKIDSALRRIDEGEYGYCEVT
GEPISLKRLDARPIATMSLEAQERHERREKVHRDD
Download sequence
Identical sequences A0A0P8AJH4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]