SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P8DUN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P8DUN2
Domain Number 1 Region: 101-166
Classification Level Classification E-value
Superfamily Chondroitin AC/alginate lyase 0.000000000897
Family Alginate lyase A1-III 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P8DUN2
Sequence length 166
Comment (tr|A0A0P8DUN2|A0A0P8DUN2_9EURY) Alginate lyase {ECO:0000313|EMBL:KPQ41115.1} KW=Complete proteome; Reference proteome OX=1719120 OS=Candidatus Methanoperedens sp. BLZ1. GN=MPEBLZ_04338 OC=Candidatus Methanoperedenaceae; Candidatus Methanoperedens.
Sequence
EFRLYGPGELWIDDVNLSLTKTIPTPVPSSTPTPVPTATPSGYTSDHPGMYLNANEIDAI
IKKVDSGQQPWKEAYDKFMNEDVPAALNTKIQSVTYGGKVPPSGDIHDYFSETPYTSDGV
YNPYADKSDYYGAIAVGKAVRNLGLAYALTGENKYADKAVQLINAW
Download sequence
Identical sequences A0A0P8DUN2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]