SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P8Y331 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P8Y331
Domain Number 1 Region: 5-234
Classification Level Classification E-value
Superfamily 14-3-3 protein 4.84e-105
Family 14-3-3 protein 0.00000000671
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P8Y331
Sequence length 248
Comment (tr|A0A0P8Y331|A0A0P8Y331_DROAN) Uncharacterized protein, isoform E {ECO:0000313|EMBL:KPU76152.1} KW=Complete proteome; Reference proteome OX=7217 OS=Drosophila ananassae (Fruit fly). GN=Dana_GF12019 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRS
SWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVF
YLKMKGDYYRYLAEVATGDARNNVVEDSKKAYQEAFDIAKSKMQPTHPIRLGLALNFSVF
YYEIINSPARACHLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGD
EPQEGGDN
Download sequence
Identical sequences A0A0P8Y331
XP_014763041.1.52611 XP_014763042.1.52611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]