SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P9LQ59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P9LQ59
Domain Number 1 Region: 88-155
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 2.62e-28
Family Cyanase C-terminal domain 0.0000305
Further Details:      
 
Domain Number 2 Region: 4-84
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.28e-20
Family Cyanase N-terminal domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P9LQ59
Sequence length 155
Comment (tr|A0A0P9LQ59|A0A0P9LQ59_9PSED) Cyanate lyase {ECO:0000256|HAMAP-Rule:MF_00535} KW=Complete proteome OX=264453 OS=Pseudomonas syringae pv. coriandricola. GN=ALO76_03459 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MPHSNMSRTPRQDLTERVLRAKTAKNLTWASLADDTGLSVVYVTAALLGQHPLPQAVAEV
VAERLGLDRDAVAELQTIPLRGNVEDVSSDPTIYRFHEMVQVYGTTLKALVHEQFGDGII
SAINFKLDIRKVEDPEGGERAVITLDGKFLPYKPF
Download sequence
Identical sequences A0A0N0GGI2 A0A0N0W5D9 A0A0P9LFL4 A0A0P9LQ59 A0A1I4NCZ6 F3HQ30
WP_007252061.1.46317 WP_007252061.1.49217 WP_007252061.1.52488 WP_007252061.1.75137 WP_007252061.1.87572 WP_007252061.1.89797 WP_007252061.1.93459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]