SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P9NXS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P9NXS7
Domain Number 1 Region: 8-62
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.00000000000654
Family H-NS histone-like proteins 0.0016
Further Details:      
 
Domain Number 2 Region: 98-141
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.000000301
Family H-NS histone-like proteins 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P9NXS7
Sequence length 150
Comment (tr|A0A0P9NXS7|A0A0P9NXS7_PSESX) DNA-binding protein {ECO:0000313|EMBL:KPX11739.1} KW=Complete proteome OX=264455 OS=Pseudomonas syringae pv. daphniphylli. GN=ALO73_02309 OC=Pseudomonadaceae; Pseudomonas; Pseudomonas syringae.
Sequence
MAANAYEDVMRVLSNVRSIRAFVRENDYELLLEAHEKLGVALDERKEEYAAEKLEREARE
VKRQELLALIESEGFDLGQLAGGDFEPKARKKSRTSTQKREPKYEFVEDGVTKYWAGVGR
KPRPIAQAIENGASLSDFLIKAEEQQSLDV
Download sequence
Identical sequences A0A0P9NXS7
WP_044322618.1.35401 WP_044322618.1.51882 WP_044322618.1.89047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]