SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P9TIQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P9TIQ8
Domain Number 1 Region: 17-123
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 4.53e-30
Family Frataxin-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P9TIQ8
Sequence length 201
Comment (tr|A0A0P9TIQ8|A0A0P9TIQ8_PSEA0) Iron-sulfur cluster assembly protein CyaY {ECO:0000256|HAMAP-Rule:MF_00142, ECO:0000256|SAAS:SAAS01015787} KW=Complete proteome OX=251724 OS=Pseudomonas amygdali pv. photiniae. GN=ALO53_04836 OC=Pseudomonadaceae; Pseudomonas; Pseudomonas amygdali.
Sequence
MRPYLAPLRYLQTLIEVPAMSLTEARFHDLVDATQQVLEDVFDESGLDVDLENSAGVLTV
KFENGSQLIFSRQEPLRQLWLAARSGGFHFDYDQENSRWACDTSDELLSEMLARITLEQA
GVELDFGQSPVRPPKPLFSNVSPAVASPCISLCRLDEQKVCLGCFRHVEDIREWRSADDH
RRRQIRHEAEQRRASAGQTAG
Download sequence
Identical sequences A0A0P9TIQ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]