SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q0B607 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q0B607
Domain Number 1 Region: 286-367
Classification Level Classification E-value
Superfamily Methylated DNA-protein cysteine methyltransferase, C-terminal domain 1.15e-30
Family Methylated DNA-protein cysteine methyltransferase, C-terminal domain 0.0000334
Further Details:      
 
Domain Number 2 Region: 23-109
Classification Level Classification E-value
Superfamily Ada DNA repair protein, N-terminal domain (N-Ada 10) 1.57e-24
Family Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.00039
Further Details:      
 
Domain Number 3 Region: 205-285
Classification Level Classification E-value
Superfamily Methylated DNA-protein cysteine methyltransferase domain 2.35e-19
Family Methylated DNA-protein cysteine methyltransferase domain 0.00046
Further Details:      
 
Domain Number 4 Region: 107-149
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000341
Family AraC type transcriptional activator 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0Q0B607
Sequence length 390
Comment (tr|A0A0Q0B607|A0A0Q0B607_9PSED) ADA regulatory protein / Methylated-DNA--protein-cysteine methyltransferase {ECO:0000313|EMBL:KPY88127.1} KW=Complete proteome OX=129140 OS=Pseudomonas syringae pv. tagetis. GN=ALO44_02669 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MKTQGGATTMESTEDRVAQRAPRTEDDPRWSALINRRSGIDADFVYGVLTTGIYCKPCSP
SKLPKPENVVFFDTASEAQAAGFRPSMRDSSDQQSVALKHAAAVSEACRLIDTFDSMPNL
NDLAERVGMSSFHFHRTFKKLTGLTPKAYSVASLRSRVKVRLSHDGTITSALYEAGFNSN
SRFYEASQKMLGMKPSEYRAGGANVDIRFALGESSLGSILVARSTKGICAISLGDDPNVL
VERFQDQYPNANLIGGDEAFEQLVAEVVGFVESPAIGLALPLDIRGTVFQERVWQALRDI
PAGSTATYTDIATRLGMPSAVRAVANACGANKLAVAIPCHRVVRSDGSLSGYRWGVERKR
KLLELERKADDFRLDDGQQHDGKSCDVRKG
Download sequence
Identical sequences A0A0Q0B607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]