SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0Q3PWY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q3PWY1
Domain Number 1 Region: 191-346
Classification Level Classification E-value
Superfamily MIR domain 9.16e-38
Family MIR domain 0.0042
Further Details:      
 
Domain Number 2 Region: 990-1081
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.56e-17
Family SPRY domain 0.059
Further Details:      
 
Domain Number 3 Region: 605-753
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000427
Family SPRY domain 0.064
Further Details:      
 
Domain Number 4 Region: 3423-3483
Classification Level Classification E-value
Superfamily EF-hand 0.000000109
Family Calmodulin-like 0.028
Further Details:      
 
Domain Number 5 Region: 382-495
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000144
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 
Domain Number 6 Region: 1245-1362
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000127
Family SPRY domain 0.019
Further Details:      
 
Domain Number 7 Region: 1710-1831,1862-1913,1989-2037,2289-2338,2472-2543,2584-2598,2680-2767,2814-2881
Classification Level Classification E-value
Superfamily ARM repeat 0.0000748
Family MIF4G domain-like 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0Q3PWY1
Sequence length 4375
Comment (tr|A0A0Q3PWY1|A0A0Q3PWY1_AMAAE) Uncharacterized protein {ECO:0000313|EMBL:KQK85619.1} KW=Complete proteome; Reference proteome OX=12930 OS=Amazona aestiva (Blue-fronted Amazon parrot). GN=AAES_38931 OC=Coelurosauria; Aves; Neognathae; Psittaciformes; Psittacidae; Amazona.
Sequence
MIMPGGIQKTGFRKVKYLQCYECVDGKLYVPPDLCICNFVLEQSLSVRALQEMLAXTGDN
ASDGAAQGGGHRTLLYGHAILLRHSFSEMYLTCLTSSRSQTDKLAFDVGLRENAAGEACW
WTIHPASKQRSEGEKVRIGDDLILVSVSSERYLHLSISNGSIQVDASFMQTLWNVHPTCS
GSNITEGYLLGGHVVRLFHGHDECLTVPSTDQNDSQHNWSGSNIRWGQPFRLRHITTGKY
LSLSEDEGLAMLDREKSDTTSTAFCFRVSKELKEKQDSSLKRDIDGMGVPEIKYGDSICF
VQHVASALWLTYKAQDAKSARLGPLKRKVILHQEGHMDDGLTLQRCQHEESQAARIIRNT
TSLFSQFISGNNRTLSPTALPVEEMAQTLQDLITYFKLPEEDLEHEDKQSKLRSLKNRQN
LFKEEGMLAIVLNCIDRLNDYNSAAHFAGFAREEHGTAWKEILNLLYKLLAALIRGNRNN
CTQFSSNLDWLISKLDRLESSSGILEVLHCILIESPEALNIIAEDHIKSIISLLDKHGRN
YKVLDVLCSLCVCNGVAVRANQNLICDNLLPRRDLLLQTRLINDVTSIRPNIFLGVAEGS
AQYKKWYFELIIDXVDPFLTAEPTHLRVGWASTSGYAPYPGGGEGWGGNGVGDDLYSYGF
DGLHLWSGRVPRAVASVNQHLLASDDVVSCCLDLGVPSISFRINGQPVQGMFENFSIEGF
FFPVVSLSAGVKVRFLFGGRHGEFKFLPPAGYAPCYEALLPKEKMKLEPVKEYKRDSDGV
RDLLGTTQFLSQASFIPCPIDTSQIRDDNKRHHPCLVEFSKLPETEKNYNLQMSTETLKT
LLALGCHIVHAHPAAEEDLKKVKLPKNYMMSNGYKPAPLDLSEVKLLPSQEFLVDKLAEN
AHNVWAKDRIKQGWTYGIQQDLKNKRNPRLVPYALLDERTKKSNRDSLREAVRTFAGYGY
NIEPPDQEIADQTVEKVSIDKIRFFRVEQSYAVKSGKWYFEFEAVTGGDMRVGWARPGCR
PDIEXGADDQAFVFEGSKGQRWHQGSGFFGRSWQSGDVVGCMINLDDKSIIFTLNGELLI
TXKGSELAFADFGIESGFVPICALGLSQIGRMNLGMDASTFKYYTMCGLQEGFEPFAVNM
NRDVAMWFSKRLPTFVNVPKSHPHIEVWRIDGTIESPPRLKVIHKTFGTQNSNSDMIYCR
LSMPIEFHSSFNFSMGVENASSDIFQKRKHSQEIAAPSTTYFYSLRIFAGQDPSSVWVGW
VTPDYHFYSXNFDLNKNCTVTVTLGDERGRVHESVKRSNCYMVWGGDVIANSQRSGRSNV
DLEIGCFVDLATGMLSFTANGKELGTCYQVEPNTKLFPATFVQPTSTNLIQFELGKLKNT
MPLSAAIFKSEERNPVPQCPPRLDVQTITPVLWSRMPNSFLKVETERVSERHGWVVQCLE
PLQMMALHIPEENRCVDILELCEQEDLMKFHYHTLKLYCSVSALGNTRVAYALCSHVDIS
QLFYTIDNQYLPGLLRSGFYDLLISIHLEYAKQAKLTMNNEFIIPVTDETRTIKLYPDET
KKHGLPGVGLSTCLKPSFNFSTPCFIVTTEERQTSSPEIPLDTLKSKAISMLTEAVQCSG
THIRDPVGGQVAFQFVPVLKLIATLLIMGVFDDDDVKQILLLIDPTVFGDHKEQTEERTE
KEEVTQVEEKAVEAGEKAMKETKAPVKGLLQTRLPESVKLQMCHLLNYFCDCELXHRVEA
IVSFADRYVSKLQYNQKFRYNELMQALNMSAALTAKKTKEFRSPPQEQINMLLNFQLGED
CPCPEEIRDELYEFHDDLLTHCGIPLEEEEEEEEDSSFTGKLRSLMYKIKGPPKAEKVEP
KEEEEKYPTTLKELISQTMVRWSQEDQIQDPELVRIMYTLLRRQYDSIGELLQALRKAYT
ISAVSVKDTINLLAALGQIRSLLSVRMGKEEEMLMINGLGSWMKITALLKCRYVLKIFIF
TGCGHKWFKLNHQLLGLSNFETVLRDVQIVFPKMVASCCRFLCYFCRISRQNQKAMFEHL
SYLLENSSVGLAFPSMRGSTPLDVAAASVMDNNELALALEEPDLDKVVTYLAGCGLQSCP
VLLAKGYPDIGWNPIEGERYLSFLRFAVFVNSESVEEXASVVVKLLIRRPECFGPDLRGE
GGNGLLAAMQEAIRISENPSRDLPSQAYKREGDVDEEEEEEIVHMGNAIMSFYSALIDLL
GRCAPEMHLIQSGKGEAIRIRSILRSLVPTEDLVGIISIPLKLSTVNKGMGSYGIAAEEE
LHLTEKLFWGIFDSLSHKFLSLLQKYDPELFRMALPCLSAIAGALPPDYLDTRIKSTLEK
QTSLDPEGNFDPKPVNTAKESLKTMLAMGWSLERTKEGGEAIMHQRENEKLRSISQSSQG
NGYSPAPLDLSNVMLSRELQGMAEVMAENYHNIWAKKKKMELESKGGGSHPLLVPYDTLT
AKEKSRDREKAQELFKFLQVNGIIISRGLNDMELDASSMEKRFAFKFLQKILKYVDSAQE
FIAHLEAIVTSGKTEKSPHDQEIKFFAKVLLPLVDQYFTNHCLYFLSSPTKTLSSSGYAS
NKEKEMVASLFCKLAALVRHRISLFGSDSATMVNCLHILAQSLDTRYAIQQPDSELIWVM
YKFHVTEFFVAYIPLGLGKTSMLKVLGMPDTVEDMCPEIPQLDGLIKEINDLAESGARYT
EMPHVIEVILPMLCNYLSYWWERGPESVPQGTGPCCTMITSEHLSIILGNILKIINNNLG
IDEASWMKRIAVYAQPIISKARPDLLKTHFIPTXEKLKKKAIKIVMEEEQVRADSKTDTQ
EAELLILDEFAVLCRDLYAFYPMLIRYVDNNRANWLKKPDADSDELFRMVAEVFILWCKS
HNFKREEQNFVIQNEINNLAFLTGDTKSKMSKSGGQDQERKKSKRRGDLYSIQTSLIVAA
LKKMLPIGLNMCTPGDQELISLAKTRYSHRDTDDEVKEHLRNNLHLQEKSDDPAVKWQLN
LYKDILKSDEPTDPERNVERVQRISAALYHLEQVEQPLRSKKAVWHKLLSKQRKRAVVAC
FRMAPLYNLPRHRSINLFLHGYQNYWIETEEYSFEEKLVQDLATLPKKDEEEEEETEKKQ
PDPLHQIILYFSRSALTERSKLEHDPLYIAYSAMMAKEKEMEKQRTLYQQARLHDRGAAE
MVLQMISASKGHTGPMVVETLKLGIAILNGGNTIVQQVGGLSLSAGGFVRFKLQELQIVE
FWLKIFVNRGMVKKCCSIMNLLEIYLDFYNSSVKGITMESISDFYWYYSGKDVIDESGQR
NFSKALAVTKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVVGFLHVFANMQMKLSQDSAQ
IELLKELLDLLKDMVVMLLSLLEGNVVNGTIGKQMVDTLVESSSNVEMILKFFDMFLKLK
DLTNSDAFKEHDPDGKGIISKKEFQKSMEAQKQYIQSEIEFLLSCAEADENDMFNYVDFV
ERFHEPAKDIGFNVAVLLTNLSEHMPXDSRLQSLLEPAESVLNYFEPYLGRIEIIGGAKK
IERVYFEISESSRMQWEKPQVKESKRQFIFDVVNEGGEQEKMELFVNFCEDTIFEMQLAS
QISETDSSERPEEEEEAESCYVMDIGDDEEEEKSLESASAFAMACVAVKKNVANFFKTIT
VKNLRKQYRKVRKMTVKEMVKLFFSFFWLLFVGMFQLFFTIVWGIFQILWSTVFGGGLVE
GAKNIKVTKILGDMPDPTQFGIHDDVMEAEKAEGAEHGISADLVQFAKGEKGEVDIISDI
FGIHTKKEGGSKHGHDAGLGDIAEILGTHIQSSLENTVHKKKGLQISEIAKAETERKAEX
EKADMEDGEKQDKAKEVQSKQLDEGKIKKKKRRHGQKIEKPEAVMANFFKALEIYQTKVL
HYLARNFYNLRFLALFVAFAINFILLFYKVTEEPLDEVDEDSNLWNSFDEEEEDEGMVFF
VLEESTGYMAPALRALAVIHTVISFVCVIGYYCLKASSESFISNVPLVVFKREKEVARKL
EFDGLYITEQPSEDDIKGQWDRLVINTPSFPNNYWDKFVKRKVINKYGDLYGAERIAELL
GLEKSALDFSPVEENEPEEASLVSWLSSIDTKYHIWKLGVVFTDNSFLYLAWYTTMSILG
HYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKF
YNKSEDEDEPDMKCDDMMTCYLFHMXVGVRAGGGIGDEIEDPAGDPYEMYRIVFDITFFF
FVIVILLAIIQGLIIDAFGELRDQQEQVREDMETKCFICGIGNDYFDTTPHGFETHTLQE
HNLANYLFFLMYLINKDETEHTGQESFVWKMYQERCWDFFPAGDCFRKQYEDQLG
Download sequence
Identical sequences A0A0Q3PWY1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]