SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0Q3SSZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q3SSZ4
Domain Number 1 Region: 217-264
Classification Level Classification E-value
Superfamily MIR domain 0.00000000000000327
Family MIR domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q3SSZ4
Sequence length 264
Comment (tr|A0A0Q3SSZ4|A0A0Q3SSZ4_SETIT) Uncharacterized protein {ECO:0000313|EMBL:KQL01274.1} KW=Complete proteome; Reference proteome OX=4555 OS=Setaria italica (Foxtail millet) (Panicum italicum). GN=SETIT_0138762mg OC=PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria.
Sequence
MSDQFCTTGGVDKHRRPTQTRQSRCHEGTGSTTSNVAPGQHASHAGTSSFAGHPLSSVAA
KNTPPRRGIRLPHFPLSRAQSSPERVKAERPEANLPEAKPPRGHDPAAVAPSTPQPPQGL
SRRRAASADNQPNTSGAATASLAGALTRERIRRRGEADAGPGGQEALPFWQKTWFLALLL
AMAAASFALALLLYLGLDLPEAAPAQSYAADPDTVVEITYGSVIKLMHERTKFRLHSHDV
PYGSGSGQQSVTSFPNVDDANSYW
Download sequence
Identical sequences A0A0Q3SSZ4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]