SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0Q3T375 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q3T375
Domain Number 1 Region: 29-200
Classification Level Classification E-value
Superfamily MIR domain 8.76e-58
Family MIR domain 0.00000251
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q3T375
Sequence length 214
Comment (tr|A0A0Q3T375|A0A0Q3T375_AMAAE) Stromal cell-derived factor 2-like protein 1 {ECO:0000313|EMBL:KQK75014.1} KW=Complete proteome; Reference proteome OX=12930 OS=Amazona aestiva (Blue-fronted Amazon parrot). GN=AAES_251158 OC=Coelurosauria; Aves; Neognathae; Psittaciformes; Psittacidae; Amazona.
Sequence
MWAGCRLFPLLLLALLRGLCHGREAAXSAVTCGSVLKLLNTRHSVRLHSHEVKYGSGSGQ
QSVTGVEASDDANSYWRIRGKSDGSCQRGTPVKCGQAIRLTHVNTGKNLHTHHFPSPLSN
NQEVSAFGDDGEGDDLDIWIVQCSGTYWEREDAVRFKHVGTXVFLSITGEQYGHPIRGQR
EVHGMPTANHHNYWKAMEGVFIKPSMDXAKHDEL
Download sequence
Identical sequences A0A0Q3T375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]