SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0Q3TTL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q3TTL5
Domain Number 1 Region: 328-522
Classification Level Classification E-value
Superfamily MIR domain 6.1e-68
Family MIR domain 0.00000000748
Further Details:      
 
Domain Number 2 Region: 524-689
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 6.02e-59
Family IP3 receptor type 1 binding core, domain 2 0.000000023
Further Details:      
 
Domain Number 3 Region: 1171-1327
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 5.89e-35
Family IP3 receptor type 1 binding core, domain 2 0.0087
Further Details:      
 
Domain Number 4 Region: 200-311
Classification Level Classification E-value
Superfamily MIR domain 5.49e-20
Family MIR domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0Q3TTL5
Sequence length 1744
Comment (tr|A0A0Q3TTL5|A0A0Q3TTL5_AMAAE) Inositol 1,4,5-trisphosphate receptor type 1-like protein {ECO:0000313|EMBL:KQK84054.1} KW=Complete proteome; Reference proteome OX=12930 OS=Amazona aestiva (Blue-fronted Amazon parrot). GN=AAES_56009 OC=Coelurosauria; Aves; Neognathae; Psittaciformes; Psittacidae; Amazona.
Sequence
MEEREPPPRCSIGEVRNGRGSKPEMTDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDR
CVVQPEAGDLNNPPKKFRGTGMYFMYVLSFLYCTSLVQKLLDLFDFREVRQALSCEITAP
KTKPLGLFGLIVGQEVKEMKLIVSFTDCLFKLCPMNRYSAQKQFWKAAKPGANSTTDAVL
LNKLHHAADLEKKQNETENRKLLGTVIQYGNVIQLLHLKSNKYLTVNKRLPALLEKNAMR
VTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGDKVVLNPVNAGQPLHASSHQLVDNPGCNE
VNSVNCNTSWKIVLFMKWSDNKDDILKGGDVVRLFHAEQEKFLTCDEHRKKQHVFLRTTG
RQSATSATSSKALWEVEVVQHDPCRGGAGYWNSLFRFKHLATGHYLAAEVNPDYEEDDLE
CQSSDASRRGLHSAQEKMAYSLVSVPEGNDISSIFELDPTTLRGGDSLVPRNSYVRLRHL
CTNTWVHSTNIPIDKEEEKPVMLKIGTSPVKEDKEAFAIVPVSPAEVRDLDFANDASKVL
GSIAGKLEKGTITQNERRSVTKLLEDLVYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQ
NILKQIFKLLQAPFTDSGDGPMLRLEELGDQRHAPFRHICRLCYRVLXHSQQDYRKNQEY
IAKQFGFMQKQIGYDVLAEDTITALLHNNRKLLEKHITAAEIDTFVSLVRKNREPRFLDY
LSDLCVSMNKSIPVTQELICKAVLNPTNADILIETKLVLSRFEFEEVSSGENALEVGEDE
EEVWLFWRDSNKEIRSKSIRELAQDAKEGQKEDRDVLSYYRYQLNLFARMCLDRQYLAIN
EISGQLDVDLILRCMSDENLPYDLRASFCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSE
IAIDDYDSSGTSKDEIKERFAQTMEFVEEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNL
IYFGFYNFCDLLRLTKILLAILDCVHITTIFPITKMAKGEESKGSNVMRSIHGVGELMTQ
VVLRGGGFLPMTPLAAAPEGNVKQTEPEKEDILVMDTKLKIIEILQSHRGIAVIAEFITL
ELLKAEVGHFFEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGALQLLFRHFSQRQEV
LQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGPDETMDGVQGENEHK
KKEEGHSKSQKPESTSSYNYRVVKEILLRLSKLCVQESASVRKSRKQQQRLLRNMGAHAV
VLELLQIPYEKAEDTRMQEIMKLAXEFLQNFCAGNXQNQALLHKHINLFLNPGILEAVTM
QHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEGKFIKKCQDMLVNA
GEDVLVFYNDRASFQTLVQMMRSERDRMDENSPLMYHIHLVELLAVCTEGKNVYTEIKCN
SLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEIYTSNHMWKLFENFLVDI
CRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQSTTLQTRQPVFVQLLQGVFR
VYHCNWLMPSXKASVESCIRVLSDVAKSRAIAIPVDLDSQVNNLFLKSHNLVQKTAMNWR
MTARNAARRDSVLAASRDYRNIIERLQDIVSALEDRLRPLVQAELSVLVDVLHRPELLFP
ENTDARRKCESGGFICKLIKHTKQLLEENEEKLCIKVLQTLREMMTKDRGYGEKITIELD
NAEV
Download sequence
Identical sequences A0A0Q3TTL5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]