SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0Q3U307 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q3U307
Domain Number 1 Region: 294-486
Classification Level Classification E-value
Superfamily MIR domain 2.22e-49
Family MIR domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0Q3U307
Sequence length 725
Comment (tr|A0A0Q3U307|A0A0Q3U307_AMAAE) Protein O-mannosyl-transferase 1 {ECO:0000313|EMBL:KQL60272.1} KW=Complete proteome; Reference proteome OX=12930 OS=Amazona aestiva (Blue-fronted Amazon parrot). GN=AAES_09980 OC=Coelurosauria; Aves; Neognathae; Psittaciformes; Psittacidae; Amazona.
Sequence
MLGFLKEPVVXNVEINMNIMVLSLMGLISRLWGLSYPRAVVFDEVYYGQFVSLYMKRIFF
VDDSGPPFGHMLLALGGYLGGFDGNFLWNRIGAEYSMNVPVWSLRLLPALAGALCVPLAY
QILVELQFSHCAALGAALLILLENSLITQSRFMLLESILIFFILLAVLSYLKFYNLQKHS
SFSGSWWFWLLLTGVACSCAVGVKYMGLFTYILLLTIAGLHFWHVIGDQNLSNVSLMCHF
LARGLALIVIPVAMYVSFFYVHLTLLYRSGPHDQIMTSAFQASLEGGLARITQGQPLEVA
YGSQITLRNVLGKPMQCWLHSHTNTYPIRYENGRGSSHQQQVTCYPFKDVNNWWIVKDPG
MQQLVVSNPPRPVXHXDIVQLVHGITTRYLNTHDVAAPVXPHSQEVSCYIDYNISMPAQN
LWRVEIVNRESDTDVWKTILSEVRFVHVNTSAVLKLSGASLPEWGYRQLEVVGEKLSKGY
HQSMVWNVEEHRYGKSLEQKEREVELHSPTQMDISKNLSFMAKFTELQWKILTLKNEDTE
HKYSSSALDWITMDTNIAYWLHPTSTAQIHLLGNVXTWASANVAALIYMCLSLWYLIRRR
RKIYDIPEDAWQLWVSAGGICVGGWAVNYLPFFGMEKTLFLYHYLPALTFQILLIPIVXQ
HIRDHLCRSVLLKSMFTALIVAWFSSVYFVYCAFSPVTYGEPSLSVTELKDLRWKDSWNI
LIRKQ
Download sequence
Identical sequences A0A0Q3U307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]