SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q3WE90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q3WE90
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily Hypothetical protein YojF 1.29e-44
Family Hypothetical protein YojF 0.0000396
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q3WE90
Sequence length 114
Comment (tr|A0A0Q3WE90|A0A0Q3WE90_BRECH) Uncharacterized protein {ECO:0000313|EMBL:KQL44891.1} KW=Complete proteome; Reference proteome OX=54911 OS=Brevibacillus choshinensis. GN=AN963_26495 OC=Brevibacillus.
Sequence
MQLINQSEVQRRIDDLKDQDLYIHLEMTTGAYAAHFDSSKHPAATFITNAIIRFSHGSIS
GSGPYRVGLKMEHGWVYSEGLTHYEETEPERLIMAGHDSQGKLIVSLQLSRQPF
Download sequence
Identical sequences A0A0Q3WE90
WP_055747484.1.18681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]